ELFM@4P4 pŌŌŌ  : Z°ģģģĄĄņ’üČ`j¤¬ `@ ° Hp;(pppp p‚pp&a‚Z90Fj,$ ^<6=EKbCe5Husm Q:n8+32;%i fU)#1!&'W.dx (/t"*I4l€B[gR]>7OJ-L|hkaV@_zGD?ASPMN`Tc\{XY} pr qo~vwyM@@ŃPT{& #Č`’ńōŁ8|KÜČ4–Õ<‚Č`’ńŪ@lÄÖÜš ŚXä8ŃHßɀd*Ū¬`Ł“¤4M˜T)Š|ŒtM@RÓXHJ ’ńčŲĢlO1$ ®Õ¼dxÓš„øÖ ¼£Õ@|‡Ōt†J ’ńHp’ńŸj°’ńŪŲ`lIѤ\<Ü ¼M€™J ’ńaÓ P Š`‹āLā€TZ āp“q]`¶ā`ä7āP4Ž4}ā@ 7&<ģźā0@éā ¤Č?Š $āČāōįšōįąŌ—Įä<„Ā 8 ĪšplįŠ,J ĮįĄ“œ&Ų ńį°|Ęį L¤d|ūÉTdšįTrƒLį€,ZWČ  įpšį`˜ęµō €>ü SįPį@"ż?į0ŌĪ“œōXį °łįcXh¼Ō·x¬½įh^ąš¼¬ąąĢąŠäEąĄ”FU€xŁēXT±ą°0”ą „fąDŽc4 ōą€¶ĀX({ąpp®fŒøQą`Ģn[<œ©ąPTą@„b،ą0 Lą ”bą4AJ üąT ßšč¢ßąø„ߊ4 *ߥć×Ģ”D-4,#ß°x“Ņß @¾ߐ˜>č 0g߀Xݵd°ßph_ÓXŪÜü8žß`$/ßP_GLOBAL_OFFSET_TABLE_wl_cmd_init_gp_dispint_fmtfreq2channelswapminiopt_initmemsetwl_atoipwl_ether_atoewl_printintstrlenmemcpyfreemallocwl_setstrcpywl_getstrncmp__ctype_bmemmovesprintfwl_format_ssidwl_iptoawl_ether_etoastrtolwl_varintstderrfputswl_checkstrcmpwc_cmd_checkputchardump_ratesetwl_hexdumpwl_dump_raw_iestrncpyfprintfwl_printlasterrorav0cmd_usagewl_cmds_usagewl_cmdswl_optionminioptstrchrstrcasecmpcntry_nameswl_intwf_chspec_atonstrspnstrcspnstrtokfopenfwritefclosewf_chspec_ntoausleepfgetsstdouttoupperfreadferrorfeoffflushmemcmpbcm_next_tlvfputcwl_usagestrncasecmpbcm_brev_strffswl_varcmdperrorsocketioctlwl_libmainstrsep__errno_locationstdinwlctl_cmdfilenodupfreopendup2clearerrbcm_strtoulbcm_ctypebcm_atoibcm_ether_atoehndcrc8hndcrc16hndcrc32bcm_parse_tlvsbcm_parse_ordered_tlvsbcm_qdbm_to_mwbcm_mw_to_qdbmbcm_bitcountbcmstrncatbcmstrcatbcm_mkiovarbcmdumpfieldssnprintfbcm_chipnamebcm_ip_ntoabcm_ether_ntoaprintbigbcmstrstrwf_chspec_malformedwf_chspec_ctlchanwf_mhz2channelwf_channel2mhz__ctype_tolowerlibc.so.0_ftext_fdata_gp_edata__bss_start_fbss_endlibwlctl.so (4@LXdp|ˆ” ¬øÄČĢŠŌŲÜąčšų (4DTdt„”¤“ÄŌäō$4DTdt„”¤“ÄŌäō$4DTdt„”¤“ÄŌäō$4DTdt„”¤“ÄŌäō$4DTdt„”¤“ÄŌäō$4DTdt„”¤“ÄŌäō$4DTdt„”¤“ÄŌäō$4DTdt„”¤“ÄŌäō$4DTdt„”¤“ÄŌäō$4DTdt„”¤“ÄŌäō$4DTdt„”¤“ÄŌäō$4DTdt„”¤“ÄŌäō$4DTdt„”¤“ÄŌäō$4DTdt„”¤“ÄŌäō$4DTdt„”¤“ÄŌäō   $ 4 D T d t „ ” ¤ “ Ä Ō ä ō!!!$!4!D!T!d!t!„!”!¤!“!Ä!Ō!ä"""$"4"D"T"d"t"„"”"¤"“"Ä"Ō"ä"ō###$#4#D#T#d#t#„#”#¤#“#Ä#Ō#ä#ō$$$$$4$D$T$d$t$˜$ $Ø$°$ø$Ą$Č$Š$Ų$ą$č$š$ų%%%%% %(%0%8%@%H%P%X%`%h%p%x%€%ˆ%%˜% %Ø%°%ø%Ą%Č%Š%Ų%ą%č%š%ų&&& &&& &$&(&4&8&<&H&L&P&\&`&d&p&t&„&ˆ&Œ&˜&œ& &¬&°&“&Ą&Ä&Č&Ō&Ų&Ü&č&ģ&š&ü''''''$'(','8'<'@'L'P'`'d'h't'x'|'ˆ'Œ''œ' '¤'°'“'ø'Ä'Č'Ģ'Ų'Ü'ą'ģ'š'ō(((((((((,(0(<(@(P(T(d(h(x(|(Œ((”( (¤(Ø(“(ø(Č(Ģ(Ü(ą(š(ō))) ))) ),)0)4)@)D)H)T)X)\)h)l)p)|)€))”)¤)Ø)¬)ø)¼)Ą)Ģ)Š)Ō)ą)ä)č)ō)ų)ü** *** *$*0*4*8*D*H*L*X*\*`*l*p*€*„*ˆ*”*˜*Ø*¬*°*¼*Ą*Ä*Š*Ō*Ų*ä*č*ģ*ų*ü++ +++ +$+4+8+<+H+L+P+\+`+d+p+t+x+„+ˆ+Œ+˜+œ+ +¬+°+“+Ą+Ä+Č+Ō+Ų+Ü+č+ģ+š+ü,,,,,,$,(,,,8,<,@,L,P,`,d,t,x,|,ˆ,Œ,œ, ,¤,°,“,ø,Ä,Č,Ģ,Ų,Ü,ą,ģ,š,ō-------(-,-0-<-@-P-T-X-d-h-x-|-€-Œ--”- -¤-Ø-“-ø-¼-Č-Ģ-Š-Ü-ą-ä-š-ō-ų... ... .,.0.4.@.D.H.T.X.\.h.l.p.|.€.„..”.¤.Ø.ø.¼.Ą.Ģ.Š.Ō.ą.ä.č.ō.ų.ü// /// /$/0/4/8/D/H/L/X/\/`/l/p/t/€/„/ˆ/”/˜/Ø/¬/°/¼/Ą/Ä/Š/Ō/Ų/ä/č/ģ/ų/ü0 000 0$04080H0L0\0`0p0t0„0ˆ0˜0œ0¬0°0“0Ą0Ä0Č0Ō0Ų0Ü0č0ģ0š0ü111111$1(181<1@1L1P1`1d1t1x1ˆ1Œ1œ1 1°1“1ø1Ä1Č1Ģ1Ų1Ü1ą1ģ1š22222(2,2<2@2D2P2T2X2d2h2l2x2|2Œ22 2¤2“2ø2Č2Ģ2Ü2ą2š2ō2ų33333 3,30343@3D3H3T3X3\3h3l3p3|3€33”3˜3¤3Ø3¬3ø3¼3Ą3Ģ3Š3Ō3ą3ä3č3ō3ų44 44 4044484D4H4L4X4\4`4l4p4€4„4ˆ4”4˜4Ø4¬4°4¼4Ą4Ä4Š4Ō4Ų4ä4č4ģ4ų4ü55 55 5$54585H5L5P5\5`5d5p5t5x5„5ˆ5Œ5˜5œ5 5¬5°5“5Ą5Ä5Č5Ō5Ų5Ü5č5ģ5ü666666$6(6,686<6@6L6P6`6d6h6t6x6ˆ6Œ66œ6 6¤6°6“6ø6Ä6Č6Ģ6Ų6Ü6ą6ģ6š6ō7777777(7,707<7@7D7P7T7X7d7h7l7x7|7€7Œ77”7 7¤7Ø7“7ø7¼7Č7Ģ7Š7Ü7ą7ä7š7ō7ų888 888 8,80848@8D8T8X8\8h8l8p8|8€8„88”8¤8Ø8¬8ø8¼8Ą8Ģ8Š8Ō8ą8ä8ō8ų99 999 9$9094989D9H9L9X9\9`9l9p9t9€9„9ˆ9”9˜9œ9Ø9¬9°9¼9Ą9Ä9Š9Ō9Ų9ä9č9ģ9ų9ü: ::: :$:(:4:8:<:H:L:P:\:`:d:p:t:x:„:ˆ:Œ:˜:œ: :¬:°:“:Ą:Ä:Č:Ō:Ų:Ü:č:ģ:š:ü;;;;;;$;(;,;8;<;L;P;`;d;h;t;x;|;ˆ;Œ;;œ; ;¤;°;“;ø;Ä;Č;Ģ;Ų;Ü;ą;ģ;š;ō<<<<<<<(<,<0<<<@> >>> >$>0>4>8>D>H>L>X>\>`>l>p>t>€>„>ˆ>”>˜>œ>Ø>¬>°>¼>Ą>Ä>Š>č>ų>ü???? ????? ?$?(?,?0?4?8?<?@?D?H?L?P?T?X?\?`?d?h?l?p?t?x?|?€?„?ˆ?Œ??”?˜?œ? ?¤?Ø?¬?°?“?ø?¼?Ą?Ä?Č?Ģ?Š?Ō?Ų?Ü?ą?ä?č?ģ?š?ō?ų?ü@@@@ @@@@@ @$@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@h@l@p@t@x@|@€@„@ˆ@Œ@@”@˜@œ@ @¤@Ø@¬@°@“@ø@¼@Ą@Ä@Č@Ģ@Š@Ō@Ų@Ü@ą@ä@č@ģ@š@ō@ų@üAAAA AAAAA A$A(A,A0A4A8A<A@ADAHALAPATAXA\A`AdAhAlApAtAxA|A€A„AˆAŒAA”A˜AœA A¤AØA¬A°A“AøA¼AĄAÄAČAĢAŠAŌAŲAÜAąAäAčAģAšAōAųAüBBBB BBBBB B$B(B,B0B4B8B<B@BDBHBLBPBTBXB\B`BdBhBlBpBtBxB|B€B„BˆBŒBB”B˜BœB B¤BØB¬B°B“BøB¼BĄBÄBČBĢBŠBŌBŲBÜBąBäBčBģBšBōBųBüCCCC CCCCC C$C(C,C0C4C8C<C@CDCHCLCPCTCXC\C`CdChClCpCtCxC|C€C„CˆCŒCC”C˜CœC C¤CØC¬C°C“CøC¼CĄCÄCČCĢCŠCŌCŲCÜCąCäCčCģCšCōCųCüDDDD DDDDD D$D(D,D0D4D8D<D@DDDHDLDPDTDXD\D`DdDhDlDpDtDxD|D€D„DˆDŒDD”D˜DœD D¤DØD¬D°D“DøD¼DĄDÄDČDĢDŠDŌDŲDÜDąDäDčDģDšDōDųDüEEEE EEEEE E$E(E,E0E4E8E<E@EDEHELEPETEXE\E`EdEhElEpEtExE|E€E„EˆEŒEE”E˜EœE E¤EØE¬E°E“EøE¼EĄEÄEČEĢEŠEŌEŲEÜEąEäEčEģEšEōEųEüFFFF FFFFF F$F(F,F0F4F8F<F@FDFHFLFPFTFXF\F`FdFhFlFpFtFxF|F€F„FˆFŒFF”F˜FœF F¤FØF¬F°F“FøF¼FĄFÄFŌFÜFģFōFüGGGG$G,G4G<GDGLGTG\GdGlGtG|G„GŒG”GœG¤G¬G“G¼GÄGĢGŌGÜGäGģGōGüHH HHH$H,H<HDHLHTH\Hd'TB4$B4tB4œB6TB6|B8HB8˜B:B;@B;TBģB&xS(DS(XS(lS(€S(¼S(ŠS(äS(ųS)„S)˜S*tS*œS+(S,TS,hS,S-DS-lS.˜S.¬S/œS0S0(S0<S0PS0dS0xS0ŒS0 S1,S1TS1hS1|S1S1¤S1ōS2S2S20S2€S2”S2ØS2¼S2ŠS2äS3 S3„S3üS4S5S5(S5<S5šS8čS8üS0„’’0‚’"ą‚%0‚’.E%0c’C%&ąD%<'œzą™ą!‚€ą @<'œzČ™ą!‚€!$EˆŒ¢D$„‚€Ą$B„b!ąŒb$c$.b’ō!ą (¢‚Fƒ$b¢*@ć(# !(¢$ˆ@’ō$§’ž !ą€!… !$ƒ‚b$„ą!¦*@’ų$„ą$<'œyō™ą!0„’$ƒ’g(b)@`H!ą4’’$„’?$0!§@!&!$Ę(†!8Ą@’ś(@‚€@$B4b!”bBC!Hōą0B’’<'œyp™ą!0…’’,¢@$ ™ą!d(!%)’Ų,¢] Ą@’ū@‚€8!$F4”Ä”Ć$čd#ĀC!CD!¢+@$Ę1’$'ā’ņé!ą0B’<'œxą™ą!'½’ŲÆæ Æ±ưƼ‚T€€!Q ”‚™€'9M@ ų @ !¼¦ –™€'9M@ ų @ !¼¦ Ž™€'9MX ų @ !¼® – ™€'9M@ ų @ !¼¦  –™€'9M@ ų @ !¼¦ Ž™€'9MX ų @ !¼® Ž™€'9MX ų @ !¼® Ž™€'9MX ų @ !¼® Ž™€'9MX ų @ !¼® Ž ™€'9MX ų @ !¼®  Ž$™€'9MX ų @ !¼®$ Ž(™€'9MX ų @ !¼®( Ž,™€'9MX ų @ !¼®, Ž0™€'9MX ų @ !¼®0 Ž4™€'9MX ų @ !¼®4 Ž8™€'9MX ų @ !¼®8 –<™€'9M@ ų @ !¼¦< –>™€'9M@ ų @ !¼¦>æ ±°ą'½(<'œv`™ą!'½’ŲÆæ Æ±ưƼ‚T€€!Q ”‚™€'9M@ ų @ !¼¦ –™€'9M@ ų @ !¼¦ Ž™€'9MX ų @ !¼® – ™€'9M@ ų @ !¼¦  –™€'9M@ ų @ !¼¦ Ž™€'9MX ų @ !¼® Ž™€'9MX ų @ !¼® Ž™€'9MX ų @ !¼® Ž™€'9MX ų @ !¼® Ž ™€'9MX ų @ !¼®  Ž$™€'9MX ų @ !¼®$ Ž(™€'9MX ų @ !¼®( Ž,™€'9MX ų @ !¼®, Ž0™€'9MX ų @ !¼®0 Ž4™€'9MX ų @ !¼®4 Ž8™€'9MX ų @ !¼®8 –<™€'9M@ ų @ !¼¦< –>™€'9M@ ų @ !¼¦>æ ±°ą'½($’¢(%$&¤‚<$¤‚$@¤‚$4 ‚ $€Š¤‚ $Ф‚<˜4B–€¬‚$’’¬‚$*< ‚@<[4cE$N 4B€ …¬†¬ƒ,¬‚8 € ¬†¬ƒ$ą¬ƒ($’‚¢(%$&¤‚<$¤‚$@¤‚$  ‚ $–¤‚ $ܤ‚$’’¬‚$* ‚@<[$ 4B€ …¬ƒ,¬‚8 € ¬ƒ$¬ƒ(଀<'œrą™ą!'½’ŲÆæ$Ʋ ƱưƼ™€Š €!€ˆ!Ą!(! ų $˜¼@®0‚€ ŒB& ®"®2æ$² ±°ą'½(<'œrh™ą!'½’ŲÆæ$Ʋ ƱưƼ™€Š €!Ą!€ˆ!(!Ą ! ų $.@2¼’"’$&’žD!,c`,¦B&’ś&",£`'®B&&Ā’#C!0B’’ €$‚¢+@¤#$E’ž,¢@®F&"D0!ĀĆC!0B’’ €$‚¢+@ ¤#$B’ž,B@®F $ĀD!!®B$!æ$² ±°`!ą'½(<'œq,™ą!'½’ŠÆæ(Ƴ$Ʋ ƱưƼā™€Š€€!0Ņ’ ˜!$F(! ų ąˆ!¼¢’"¢’"`¢Žb$B®bæ(³$² ±°!ą'½0<'œp˜™ą!'½’ŠÆæ,Ʋ(Ʊ$ư Ƽ€0! !€!'±™@Ą ! (! ų 0!¤P!¼ b€ƒ$.$„€0!&bƤ$’ļ™@:æ,²(±$° ,Bą'½0<'œoų™ą!'½’ČÆæ0Ƴ,Ʋ(Ʊ$ư Ƽ !™€Š€ˆ!(!@ ! ų $¼€!'³™@ !`(! ų $¤P!¼ b€‚$„€ˆ!&@Ƥ$’š™@:æ0³,²(±$° ,Bą'½8<'œo<™ą!'½’ŲÆæ$Ʋ ƱưƼ”†$Ā€ˆ!„€$™$„ā° $”ƒ,b@@ ™„€$$„āģ`0!$@æ$² ±° '½(Œ‚0C` ‚€$$b ‚€$f‚€$‚€$$Rć $Rć,$Rć4$Rć<„€$™$„ ¤$ ų  €!¼–%„€$™Č! ų $„ćH¼’%„€$™0„$„ćT(BČ! ų @0!¼’%„€$™’& ’' Č! ų $„ć`’" ¼0C0D8‚€$E‚€`$F ĆE!’#B0c`F!C`E$b $b„€$ ™„€$™$„ć€„€$™ $„ćœ $„ćøĆE!B„€$F!E™$„ćŲČ! ų ¼–% A‚€$‚€$$Fćų$Fȏ„€$™$„ä0„’ ų  €!¼–%„€$™Č! ų $„䏼Ž%„€$™Č! ų $„ä0¼Ž%„€$™Č! ų $„äH¼Ž%„€$™Č! ų $„ä`¼Ž%„€$™Č! ų $„äx¼Ž% „€$™Č! ų $„䐏¼Ž%$„€$™Č! ų $„䤏¼Ž%(„€$™Č! ų $„äø¼Ž%,„€$™Č! ų $„äĢ¼Ž%0„€$™Č! ų $„䱏¼Ž%4„€$™Č! ų $„äō¼Ž%8„€$™Č! ų $„叼–%<„€$™Č! ų $„叼–%>„€$™æ$Č!² ±°$„å( '½(<'œkd™ą!'½’ŠÆæ(Ƴ$Ʋ ƱưƼ“€$…€!Ą! ˆ!’’’0¢Ą1@Ć0#Ā0! ų (‚¼2*™&då8&1@’ņ&æ(³$² ±°ą'½0<'œjŠ™ą!‚€C$b€(!$b „€$™„€$™$„åD$„„€$™$„ņ <'œjp™ą!'½’ČÆæ4ƶ0Ƶ,Æ“(Ƴ$Ʋ ƱưƼ™€\°LÆ„<Ą°!ą! ų € !@0!¼§HµP$B R˜!+@$Ń$’ņ!+®¢‚€$$šŒCåH$BåHØćøćC™d ćC ! ćB€(! ā ų  0!¼€!‚TB@¤<™€'9MX ų ¼€!Ŗŗ@Æ¢<™d&Ą(! ų @0!¼® `!æ4¶0µ,“(³$² ±°`!ą'½8<'œi™ą!'½’ŲÆæ Æ±ưƼ‚€  ŒPJ¤Ž Ž@@ ! ų ¼™€< ų  !¼ €!’󏙀<‚€ æ $CJ¤¬`±ƒ€ °'½(¬`Ją¬@J¤<'œh„™ą!'½’ČÆæ4ƶ0Ƶ,Æ“(Ƴ$Ʋ ƱưƼ‚€   !BJĄ°!@Yąˆ!™H$ ų  ˜!¼@€!@ ’€ „€$ŽFJ™$„åP ų $7¼„€$ŽEJ™$„å”$„€0! ų  Ø!¼ !™H®®`Č! ų ®¼@® „€$™ŽFJ Č!$„åP ų  (!¼™€< ų  !¼™d@ !Ą(! ų  0!¼ƒ€ $bJ¤ŒB@¬P¬pJ¤„€ ‚€ ŒƒJ(!$c¬PJجƒJ™€'9_L ų ¼ƒ€ bJ@„€$$’’ `J™\ ų $„小¼ $’’™€€æ4¶0µ,“(³$² ±° '½8æ4¶0µ,“(³$² ±° !ą'½8<'œf€™ą!'½’ĄÆæ8Ʊ4ư0Ƽ ¢X™€°TÆ¢€ˆ!'¢(  !Ą(!ą0!§PÆ¢'9]š ų ư@8!¢(@¼ ™€ !0!'9_Ü ų $¼ æ8±4°0ą'½@<'œe虹!'½žĄÆæ<Æ“8Ƴ4Ʋ0Ʊ,ư(Ƽ '“(™€Š€ˆ! !Ą˜!€ !(!$ ų ą€!¼ ¢P™€Æ¢$Æ“ !@(!`0!8!'9aą ų Æ¢¼ æ<“8³4²0±,°(ą'½@<'œe<™ą!'½’ŠÆæ,Ʋ(Ʊ$ư Ƽ‚T€!B €!Ąˆ!@Ƨ<™€'9MX ų ą !¼ą!™€Æ¢<$@ !(! 0!'§<'9bx ų Æ¢¼æ,²(±$° ą'½0<'œdœ™ą!'½’ŠÆæ,Æ“(Ƴ$Ʋ ƱưƼ‚€ ™€ŠŒR €!€ !(!@ !Ą˜!$  ų ąˆ!¼(!™¤ ų @ !¼™€\ ų  !$P ¼™d`(!P ! ų  0!¼™€08!€ !@0!æ,“(³$² ±°$'9_Ü '½0<'œcÄ™ą!'½’ŠÆæ,Ʋ(Ʊ$ư ƼŒĆ€! ˆ!`$Š„€$™\$„åō‚TB@ ™@` !(! ų 0!¼™€'9MX ų @ !Ž` !(! ų 0!Ž¼€ Æ¢„€$™\$„ę ų ¼$’’‚TB@ ™@(! ų 0!¼™€'9MX ų @ !¼(! ų 0!¼Ž%™€@ !'¦$'9cÄ ų Æ¢¼æ,²(±$° ą'½0<'œb|™ą!Œ¢ @™€Œ„0!'9cÄ 8!ą$’’<'œbH™ą!™€$£0!'9_Ü 8!<'œb$™ą!Œ„  ™€0!'9_Ü 8!ą$’’<'œaō™ą!'½’௿Ƽ‚€ BJ@ !,¢@$u¢$¢™™€„æ`(! '½ „€$ ų $„ę,¼æ$’žą'½ <'œa|™ą!'½’ĄÆæ<Ʋ8Ʊ4ư0Ƽ ™€°T±X'¢(€!  !Ą(!ą0!§PÆ¢ư'9]š ų Ʊ¢(@ ¼ ™€@ !0! 8!'9fl ų $¼ æ<²8±4°0ą'½@<'œ`Ü™ą!'½žøÆæDƶ@Ƶ<Æ“8Ƴ4Ʋ0Ʊ,ư(Ƽ ²X‚€*Cą°!$Uf䀀! ˜!` Ą !8!ƶƲ Č! ų Æ ¼ @€!™€Š'±( !(! ų $$ !`(!€0!8!ƢƠ Č! ų Ʊ@€!@¼ ™dĄ ! (! ų @0!¼ !æD¶@µ<“8³4²0±,°(ą'½H<'œ_Š™ą!'½’ŠÆæ(Ʊ$ư Ƽ™€$Æ¢'9g„ ų ąˆ!@€!@ ¼‚TB@Ž$™€'9MX ų ¼€!®"!æ(±$° ą'½0<'œ_D™ą!'½’ČÆæ0Ƶ,Æ“(Ƴ$Ʋ ƱưƼ‚€ ™€ŠŒQ €!€Ø!(! !Ą !$ ą! ų ³H¼ !™¤ ų (!¼™€\ ų  !@¼$D™d$ !€(! ų @0!¼™€®q  ! 0!æ0µ,“(³$² ±°$$ '9fl '½8<'œ^\™ą!'½’°ÆæLÆ“HƳDƲ@Ʊ<ư8Ƽ™€Š'±$Ą€!€˜!  ! !Æ  (! ų $Ž€¼„€$™\ $„ęd™@(!$  ų  !,C¼` Æ¢$„€$™\$„ę„ ų ¼C$’’‚€Ž$YiŽ…`('¢ ` ! 0!$ ų Æ¢A¼„€$™$„ęœ ų @(!¼™@Ž(!@Č! ų $ ¼£ ™€cŽ…` ! 0!$Æ¢('9cÄ ų ££,A¼„€$™\ ų $„ę¼¼` ! 0!$ ų Æ¢A¼„€$™\ ų $„ęŌ¼¢ „€$ŒFŒE™ ų $„ęģ¼!æL“H³D²@±<°8ą'½P<'œ\€™ą!'½’ĄÆæ8Ƴ4Ʋ0Ʊ,ư(Ƽ!Æ  $cŒĀ@’ż$Ę(b@8$’’™€Œ„'¢ 0!8!'9i ų Æ¢@.¼‚€ „€$ŒR™ŽE$„ē ų  €!ŽB@"¼–E$¢„€$™$„ē Č! ų $¼„€$™\“€$ ų $„ēT¼&Pˆ! ų Ž–B¼€!ŽB (!"*™&&dēl@’ō&1!æ8³4²0±,°(ą'½@<'œ[8™ą!'½’ĄÆæ<Æ“8Ƴ4Ʋ0Ʊ,ư(Ƽ…€$™€'¢ $„ēx0!8!Æ¢'9i ų Æ  @˜!@$¼° „€$™Ž ų $„ēˆ¼&„€$™\”€$ ų $„ē ¼!‚"@ &1@1@Ā0#8!™$ę&E$ē ų &„ēĄ¼&RŽB*@’ī`!æ<“8³4²0±,°(ą'½@<'œZ(™ą!'½’øÆæ@Ƶ<Æ“8Ƴ4Ʋ0Ʊ,ư(ƼŒĆ€ˆ! €!`Æ $„€$™\ ų $„åō¼D$’’‚TB@ ™@` !(! ų 0!¼™€'9MX ų @ !¼` !(! ų 0!¼Ž™€Æ¢ '¢$ !'¦ $'9i ų Æ¢@ !@#¼ƒT¢$cŒSµ ŒD`ŒQ‚€$PMXČ! ų  !Č! ų @!` !Č! ų @ˆ!¼€!`!„€$™Æ¢$„ēŠ (!@0! ų  8!¼€!æ@µ<“8³4²0±,°(ą'½H<'œX”™ą!'½’ØÆæTƾPÆ·LƶHƵDÆ“@Ƴ<Ʋ8Ʊ4ư0ƼŒĆ€ˆ! €!` Æ  „€$™\ ų $„åō¼$’’‹Æ¢(‚TB@ ™@` !(! ų 0!¼™€'9MX ų @ !¼` !(! ų 0!¼Ž™€Æ¢$'¢  !'¦$$'9i ų ƢƢ(@j¼· „€$™Žå ų $„č@¼&ń‚€Æ ,Y$^MXŽ$bŽ0Ž2Ž3 @Ž5ĄČ! ų  !ĄČ! ų @°!@ !ĄČ! ų @ !` !ĄČ! ų @!  !ĄČ! ų @€!¼ !€°!`€! !Æ¢‚€$™@8!ưĄ(!€0! ų $DčT¼!e ų &R¼Ž"…€$B+2!™@’ö$¤č“‚€$ ų $Dč¼Q!¼$P ų ’’’¼Ž"ƒ€$@B+™$dč“&R@’õ&…€$™\ ų $¤1`Ž"¹,@"!$B$’ü'9¼Cˆ$ƹ,Žā£,b+@’¤ƒT¢(æT¾P·L¶HµD“@³<²8±4°0ą'½X<'œUČ™ą!'½’ČÆæ0Ʊ,ư(Ƽ™€Œ„'¢ 0!8!Æ¢'9i ų Æ  @¼° „€$™Ž$„čŠ ų  ˆ!¼Ž„€$™ Č! ų $„čč¼Ž„€$™ Č! ų $„čō¼!æ0±,°(ą'½8<'œU ™ą!'½’ŠÆæ,ư(ƼŒĀ@Q™\™€Œ„'¢ 0!8!Æ¢'9i ų Æ  @K¼‚T° B@Ž™€'9MX ų ¼€!„€$™$„é ų @(!¼‚TB@Ž™€'9MX ų ¼€!„€$™$„é  ų @(!¼‚TB@Ž™€'9MX ų ¼€!„€$™$„é4 ų @(!¼‚TB@Ž ™€'9MX ų ¼€!„€$™$„éH ų @(!¼‚TB@Ž™€'9MX ų ¼€!„€$™$„é\ ų @(!¼‚TB@Ž™€'9MX ų ¼€!„€$™$„ép ų @(!¼‚TB@Ž™€'9MX ų ¼€!„€$™$„é„ ų @(!¼‚TB@Ž™€'9MX ų ¼€!„€$™$„é˜ ų @(!¼‚TB@Ž ™€'9MX ų ¼€!„€$™$„é¬ ų @(!¼‚TB@Ž$™€'9MX ų ¼€!„€$™$„éĄ ų @(!¼‚TB@Ž(™€'9MX ų ¼€!„€$™$„éŌ ų @(!¼‚TB@Ž,™€'9MX ų ¼€!„€$™$„éč ų @(!¼‚TB@Ž0™€'9MX ų ¼€!„€$™$„éü ų @(!¼‚TB@Ž4™€'9MX ų ¼€!„€$™$„ź ų @(!¼‚TB@Ž8™€'9MX ų ¼€!„€$™$„ź$ ų @(!¼‚TB@Ž<™€'9MX ų ¼€!„€$™$„ź8 ų @(!¼‚TB@Ž@™€'9MX ų ¼€!„€$™$„źP ų @(!¼‚TB@ŽD™€'9MX ų ¼€!„€$™$„źd ų @(!¼‚TB@ŽH™€'9MX ų ¼€!„€$™$„źx ų @(!¼„€$ ų $„ź¼!æ,°(ą'½0<'œO€™ą!'½’ŠÆæ,ư(ƼŒĀ@ė™\™€Œ„'¢ 0!8!Æ¢'9i ų Æ  @叼‚T° B@Ž™€'9MX ų ¼€!„€$™$„źŲ ų @(!¼‚TB@Ž™€'9MX ų ¼€!„€$™$„źš ų @(!¼‚TB@Ž™€'9MX ų ¼€!„€$™$„ė ų @(!¼‚TB@Ž ™€'9MX ų ¼€!„€$™$„ė  ų @(!¼‚TB@Ž™€'9MX ų ¼€!„€$™$„ė< ų @(!¼‚TB@Ž™€'9MX ų ¼€!„€$™$„ėP ų @(!¼‚TB@Ž™€'9MX ų ¼€!„€$™$„ėd ų @(!¼‚TB@Ž™€'9MX ų ¼€!„€$™$„ėx ų @(!¼‚TB@Ž ™€'9MX ų ¼€!„€$™$„ėŒ ų @(!¼‚TB@Ž$™€'9MX ų ¼€!„€$™$„ė¤ ų @(!¼‚TB@Ž(™€'9MX ų ¼€!„€$™$„ėø ų @(!¼‚TB@Ž,™€'9MX ų ¼€!„€$™$„ėŠ ų @(!¼‚TB@Ž™€'9MX ų ¼€!„€$™$„źŲ ų @(!¼„€$ ų $„ė䏼!æ,°(ą'½0<'œKŒ™ą!'½’ØÆæPƳLƲHƱDư@Ƽ ŒĀ€€!@ ˆ!„€$™\ $„ģ,™€ģ@ ! ų '„4@¼ „€$™\$„ģL ų ¼ ™€ !$u'¦,'9fl ų $@¼ 2$’’‚TB@¤,™€'9MX ų ¼ €!™€Ž%Æ¢,'¢( !'¦4$'9i ų Æ¢@¼ ²(“€$@€!ˆ!’’0¢0Ć80Ø`’CĆACƢƣ ų ÆØ¼ ŽB™"*&dģl&1@’ģ&æP³L²H±D°@ą'½X<'œJ™ą!'½’ČÆæ4Ʋ0Ʊ,ư(ƼŒŠŒ±€!™€'¢  (!0!8!'9i ų Æ¢@¼™\ ų ¤ ¼ !™€\ ų  !¼@ !™€ (!0!'9cÄ ų $G¼æ4²0±,°(ą'½8<'œIL™ą!'½’ŠÆæ,ư(Ƽ™€Œ„'¢$0!8!'9i ų Æ¢@€!@ ¼£$„€$b™£¢ b$„ņ£¢! ų —„ ¼!æ,°(ą'½0<'œHÄ™ą!'½’ČÆæ4Ʋ0Ʊ,ư(ƼŒŃ€! $ŏ„€$™\ ų $„ģ° ¼Œ„ ™€\„€$™ ų $„ģĢ¼'$’’ ų  !¼$G…€$™€'¢ $„ģģ@ ! 0!'9i ų Æ¢@€!A¼‚€ ™¤ŒP (! ų  !¼0!™€@ !$'9fl ų $ @€!@¼‚€ ™\ ų ŒD¼!æ4²0±,°(ą'½8<'œGœ™ą!'½’ČÆæ4Ʋ0Ʊ,ư(ƼŒÅÆ   €!„€$™ ų $„ģų¼)$’’…€$™€'¢ $„ķ0!8!'9i ų Æ¢@ˆ!A¼‚€ ™€ŒP@ !$ 0!'9fl ų $ @ˆ!@¼ư  °  ų ¼™€\ ų  !¼B€!‚™\ !@’ō& !æ4²0±,°(ą'½8<'œF™ą!'½žØÆæTƾPÆ·LƶHƵDÆ“@Ƴ<Ʋ8Ʊ4ư0ƼŒĀ€ø!Æ„\@Æ $ŒĀ@$„€$™\ ų $„ķ$2¼ŒĀ $b˜ ƒ€žTĄˆ!$vMX,T'°,$'µ(“Ā™@ (!0!@Ž$ ų ĄČ! ų @ !Æ¢  ų 0!Æ¢ &R¼@!Ŗr+ŗ&1@’č&¢\'¦,€ŒE™€'¢$ą !$'9i ų Æ¢A¼$’’‚TB@¤$™€'9MX ų Œ„¼Œ‚„€$™$„ ų @(!¼™€ą !'9cÄ ų $¼!æT¾P·L¶HµD“@³<²8±4°0ą'½X<'œD¼™ą!'½žĄÆæ<Ʋ8Ʊ4ư0ƼŒĆĄ€!€!`U ˆ!‚TÆ $B@ '„(™@` ! ų 0!¼™€'9MX ų @ !Ž™@` ! ų 0!Ž¼Æ¢,€Æ¢ ‚TB@ '„(™@ ų 0!¼™€'9MX ų @ !¼™@ ų 0!¼Ž%™€@ !'¦,$Æ¢0'9cÄ ų Æ¢ ¼™€Ž%'¢$@ !'¦,$'9i ų Æ¢@¼‚TB@¤$™€'9MX ų Œ„¼Œ‚„€$™$„ ų @(!¼!$’’æ<²8±4°0ą'½@<'œC™ą!'½’°ÆæLƲHƱDư@Ƽƒ€ ™€$bȌFŒGŒJŒH ŒIŒcȌBƦ(Ƨ,Æ¢8Æ£$ÆØ0Æ©4ÆŖ<Œ„'¢ 0!8!'9i ų Æ¢@!@?¼‚T° Q Ž™€'9MX ų @ !¼® Ž™€'9MX ų @ !¼® –™€'9M@ ų @ !¼Ž¦,¢@€„€$™ ų $„ķH¼$’’„€$¢!™ŒE$Ž$„ķ` ų  ˆ!–  ¼„€$™$„ķœ Č! ų 0¦’¼„€™\ ų $„’ø¼@!æL²H±D°@ą'½P<'œAt™ą!'½’ČÆæ0Ƴ,Ʋ(Ʊ$ư Ƽ‚€'²$Qfl ˜!@0!$ö$ Č! ų €€!A¼„€$™\ $„ķøŽe !@0! Č! ų $A ¼„€$™\$„ķą ų ¼$’’‚TB@¤™€'9MX ų ¼++@‚€$‚€$$Eī$Eī„€$™ ų $„ī$¼!æ0³,²(±$° ą'½8<'œ@P™ą!'½’ČÆæ4Æ“0Ƴ,Ʋ(Ʊ$ư ƼŒĀ€ˆ!@ €!1$’’‚€ ™¤ŒRŒ„ ų @ !¼Ž™€ !@0!'9fl ų $ @˜!@ ¼„€$™\”€$ ų $„īD¼@€! ˆ!Ž’ģ’žŽ’ōÆ¢ŽžÄ ų Æ¢¼€C#)@¢(#ŽBE(!"+™$„&„ī`&1@’ė&t`!æ4“0³,²(±$° ą'½8<'œ?(™ą!'½’øÆæDÆ“@Ƴ<Ʋ8Ʊ4ư0Ƽ™€Š'²€€! ˆ!$(! ų @ !¼Ž%™€ !@0!'9fl ų $@ !@9¼‚T¤B±@²(‚€$PMXČ! ų  !Č! ų @˜!@ !Č! ų @ˆ!¼€˜!@!„€$™$„īˆ 0!`(! ų @8!¼¤ ‚TB@ ±$‚€$PMXČ! ų  !Č! ų @!¼€! !„€$™$„īĢ@(! ų @0!¼€!æD“@³<²8±4°0ą'½H<'œ=¬™ą!'½’xÆæ€Æ±|ưxƼ™€Œ„'¦'9fl ų $]@ˆ!@¼“£0“°p+@™€`€!2’'9Nl ų  !¼2 Ą9@ä8#„€$™ć8!$„īų@(! ų 0‚¼ !æ€±|°xą'½ˆ<'œ<ō™ą!'½’ŲÆæ Æ¼Œ„”™€$’’'¦'9fl ų $@¼‚TB@¤™€'9MX ų ¼€!„€$2™Æ¢$„ļ 0E’ ų 0Ę’¼!æ ą'½(<'œ¼Ž$€<$’’™$@(!Č! ų 0!§¢(¢€B@1¼Ž$€/$’’™$@(!Č! ų 0!§¢*¢€B@$¼Ž$€!&1™$@(!Č! ų 0!§¢,¢€B@¼Ž$€$’’™$@(!Č! ų 0!§¢.¢€B@ ¼™€Že€ !'¦'9cÄ ų $¼$’’æD“@³<²8±4°0ą'½H<'œū|™ą!'½’@ÆæøÆµ“Æ“°Æ³¬Æ²ØÆ±¤Æ° Æ¼ ŒĀĄ!  !@g€Ø!™€Œ„'¢(0!8!Æ¢'9i ų Æ (@!@Ÿ¼ ±($Ž&<Ā„€$„€$™$„ö˜ ų $’¼ Ž"Ž&Ž'Æ¢Ž" Æ¢–"™Æ¢–"$„öŲ$Æ¢ ų  €!Ž"¼ –%–&Ž'Æ¢„€$Ž" ™$„÷(Č! ų Æ¢¼ Ž"0„€$™Ž%$Ž&(Ž',$„÷lČ! ų Æ¢¼ Ž"@„€$™–%4–&6–'8$„÷ØČ! ų Æ¢–"P¼ Ž%DŽ&HŽ'LÆ¢„€$Ž"T™$„÷čČ! ų Æ¢Ž"d¼ Ž%XŽ&\Ž'`Æ¢„€$–"h™Æ¢Č! ų $„ų4E¼ ™€p@ ! ų  €!ŽD¼ €<Æ¢l™€pČ! ų ŽD ¼ €4Æ¢0™€pČ! ų ŽD¼ €,Æ¢4™€pČ! ų ŽD¼ €$Æ¢8™€pČ! ų ŽD¼ €Æ¢<™$'³,`(!0! ų  ˆ!§¢@¢,€B@¼ ŽD€™$`(! Č! ų 0!§¢B¢,€B@¼ ŽD €™$`(! Č! ų 0!§¢D¢,€B@ł¼ ŽD$€ö™$`(! Č! ų 0!§¢F¢,€B@ķ¼ ŽD(€ź™€pČ! ų ŽD,¼ €ćÆ¢H™€pČ! ų ŽD0¼ €ŪÆ¢L™€pČ! ų ŽD4¼ €ÓÆ¢P™€pČ! ų ŽD8¼ €ĖÆ¢T™€pČ! ų ŽD<¼ €ĆÆ¢X™€pČ! ų ŽD@¼ €»Æ¢\™€pČ! ų ŽDD¼ €³Æ¢`™$`(! Č! ų 0!§¢d¢,€B@©¼ ŽDH€¦™$`(! Č! ų 0!§¢f¢,€B@¼ ŽDL€š™$`(! Č! ų 0!§¢h¢,€B@‘¼ ŽDP€Ž™$`(! Č! ų 0!Æ¢p¢,€B@…¼ ŽDT€‚™$`(! Č! ų 0!Æ¢t¢,€B@y¼ ŽDX€v™$`(! Č! ų 0!Æ¢x¢,€B@m¼ ŽD\€j™$`(! Č! ų 0!Æ¢|¢,€B@a¼ ŽD`€^™$`(! Č! ų 0!§¢€¢,€B@U¼ ŽDd€R™$`(! Č! ų 0!Æ¢„¢,€B@I¼ ŽDh€F™$`(! Č! ų 0!Æ¢ˆ¢,€B@=¼ ŽDl€:™$`(! Č! ų 0!Æ¢Œ¢,€B@1¼ ŽDp€.™$`(! Č! ų 0!Æ¢¢,€B@%¼ ŽDt€"&Pt™$`(! Č! ų 0!Æ¢”¢,€B@¼ Ž€$’’™$`(! Č! ų 0!§¢˜¢,€B@ ¼ ™€Ž…  !'¦0'9cÄ ų $l¼ @!$’’@!æøµ““°³¬²Ø±¤° ą'½Ą<'œōh™ą!'½’ŠÆæ(Ʊ$ư ƼŒĀ €!@X€ˆ!Œ„ Š™€'¦'9fl ų $@…¼‚TB@¤™€'9MX ų ¼@ !0ƒ,b@Ƥ€ƒ€$c@C!ŒB\!@„€$™\$„ų„€$™\$„ų¼ ų ¼c!„€$™\’ų$„ųō„€$™ ų $„ł(¢0B€@¼„€$™\’ģ$„łh„€$™\’č$„łd„€$™$„ł( ų  €!¢0B€@¼„€$™$„łt„€$™$„łpČ! ų ¼„€$™\’Š$„ł€™$Æ @ !'„ ų 0!@!¢€B@+¼,b@)$’’€ƒ€$cTC!ŒB\!@ Æ $$$$Æ¢‚TB@¤™€'9MX ų ¼€!™€Ž  !'¦$'9_Ü ų Æ¢¼$’’æ(±$° ą'½0<'œńš™ą!'½’ŠÆæ(Ʊ$ư ƼŒĀ €!@>€ˆ!™€Œ„'¦'9fl ų $@X¼‚TB@¤™€'9MX ų ¼@(!€(!,¢@!Æ„ƒ€€$chC!ŒB\!@„€$™\$„óD„€$™\$„ł „€$™\$„łŲ ų ¼1!„€$™\’ų$„ś„€$™\’ō$„ś(„€$™ ų $„śd"¼™$@ !'„ ų 0!Æ¢@ !¢€B@¼,‚@‚TB@™€€!'9MX ų ¼™€Ž  !'¦$'9_Ü ų Æ¢¼$’’æ(±$° ą'½0<'œš0™ą!'½’hÆæÆµŒÆ“ˆÆ³„Ʋ€Æ±|ưxƼ€Ø!  !Ą!$Ń !$„Œb@’ż$c,‚@5™€Š€œ„€$™€HŽ$„śx ų  ˆ!¼Ž„€$™€H Č! ų $„śŒ¼Ž„€$™€H Č! ų $„śÄ¼Ž„€$™€H Č! ų $„śč¼Ž„€$™€H Č! ų $„ū¼Ž„€$™€H Č! ų $„ūH¼Ž„€$™€H Č! ų $„ūx¼\$’ž'³(` !(! ų $L¼$@™$'²$Ž$§¢2@(!0! ų  €!§¢0¢$€B@G¼™$Ž$@(!Č! ų 0!£¢8¢$€B@<¼™$Ž$@(!Č! ų 0!£¢9¢$€B@1¼™$Ž$ @(!Č! ų 0!£¢:¢$¼€B@%&$ Œ„€™\„€$ $„ģ,™€ģ ų `(!@¼„€$™\$„ģL ų ¼™€'9O€ ų '¤0¼Ž…™€'¢   !`0!$L'9i ų Æ¢(C¼ $’’æµŒ“ˆ³„²€±|°xą'½˜<'œķl™ą!'½’hÆæÆµŒÆ“ˆÆ³„Ʋ€Æ±|ưxƼ€Ø!  !Ą!$Ń !$„Œb@’ż$c,‚@.™€Š€œ„€$™€HŽ$„śx ų  ˆ!¼Ž„€$™€H Č! ų $„ū¤¼Ž„€$™€H Č! ų $„śč¼Ž„€$™€H Č! ų $„ū¼Ž„€$™€H Č! ų $„ūH¼Ž„€$™€H Č! ų $„ūx¼U$’ž'³(` !(! ų $L¼'²$™$Ž$@(!0! ų  €!£¢8¢$€B@B¼™$Ž$@(!Č! ų 0!£¢9¢$€B@7¼™$Ž$@(!Č! ų 0!£¢:¢$¼€B@+&$Œ„€™\„€$ $„ģ,™€ģ ų `(!@¼„€$™\$„ģL ų ¼™€Ž…'¢   !`0!$L'9i ų Æ¢@¼° ™€'9R ų  !¼™€'9Y$ ų  !¼!$’’æµŒ“ˆ³„²€±|°xą'½˜<'œźą™ą!'½’pÆæˆÆµ„Æ“€Æ³|ƲxƱtưpƼ™€ Ø!Ą€!$u'¦$$'9fl ų € !@ˆ¼‚TB@¤$™€'9MX ų ¼€!@ Æ¢$‚€œ„€$™€HŒE ų $„ūŌs¼!& !$„Œb@’ż$c,‚@'™€Š€œ„€$™€HŽ$„śx ų  ˆ!¼Ž„€$™€H Č! ų $„ü¼Ž„€$™€H Č! ų $„śč¼Ž„€$™€H Č! ų $„ū¼Ž„€$™€H Č! ų $„ūH¼C$’ž'³,` !(! ų $D¼'²(™$Ž$@(!0! ų  €!£¢4¢(€B@0¼™$Ž$@(!Č! ų 0!£¢5¢(¼€B@$&$™$Œ„@(!Č! ų 0!£¢6¢(€B@¼™€Ž„'¢ € !`0!$D'9i ų Æ¢@¼° ™€'9R ų  !¼™€'9Y$ ų  !¼!$’’æˆµ„“€³|²x±t°pą'½<'œč@™ą!'½’øÆæ@Ƴ<Ʋ8Ʊ4ư0Ƽ ™€ ˆ!'¦,$u$'9fl ų €€!@¼ ‚TB@¤,™€'9MX ų ¼ €!@ Æ¢,‚€œ„€$™€HŒE ų $„ūŌ¼ 2$’’™€Ž%'¢( !0!8!'9i ų Æ¢@'¼ ‚T±(B@Ž$™€'9MX ų ¼ €!“€$ €!!®"’’0¢0Ć80Ø`’CĆACƢƣ ų ÆØ¼ Ž"™B*&dģl&R@’ģ&æ@³<²8±4°0ą'½H<'œęø™ą!'½’ŲÆæ Æ±ưƼ€œ„€$™€HŽ$„śx ų  ˆ!¼Ž„€$™€H Č! ų $„ü$¼Ž„€$™€H Č! ų $„śÄ¼Ž„€$™€H Č! ų $„ü@¼Ž„€$™€H Č! ų $„ül¼Ž„€$™€Hæ  Č!°±$„ü˜ '½(<'œåą™ą!'½’ŲÆæ Æ±ưƼ€œ„€$™€HŽ$„śx ų  ˆ!¼Ž„€$™€H Č! ų $„üď¼Ž„€$™€H Č! ų $„üü¼Ž„€$™€H Č! ų $„ż$¼Ž„€$™€H Č! ų $„żX¼Ž„€$™€H Č! ų $„żˆ¼Ž„€$™€H Č! ų $„żČ¼Ž„€$™€H Č! ų $„żų¼Ž„€$™€H Č! ų $„ž ¼Ž„€$™€H Č! ų $„žD¼Ž„€$™€H Č! ų $„žx¼Ž„€$™€H Č! ų $„žœ¼Ž„€$™€H Č! ų $„žČ¼Ž„€$™€H Č! ų $„žō¼Ž„€$™€H Č! ų $„’¼Ž„€$™€H Č! ų $„’D¼Ž„€$™€H Č! ų $„’h¼Ž„€$™€H Č! ų $„’ˆ¼Ž„€$™€H Č! ų $„’؏¼Ž„€$™€H Č! ų $„’ȏ¼Ž„€$™€Hæ  Č!°±$„’č '½(<'œćd™ą!'½’˜Ææ`Ʊ\ưXƼŒŠÆ  %€ˆ!™€\ ų  !0F’,Ā/¼@ £¦$‚€œ„€$™€HŒE ų $„$¼%$’’™d(! ų '¤%¼“¢$…€$™€¢! !$„L'¦$$1'9cÄ ų  @%¼@€!…€$™€'¢ $„L'¦$$1'9i ų Æ¢‡Ā¼¤ ™\ ų $„¼!æ`±\°Xą'½h<'œāH™ą!'½’ĄÆæ8Ƴ4Ʋ0Ʊ,ư(ƼŒĀ€! ˜!@$Š‚€œ„€$ŒE™€H $„X™€ģ'±@ ! ų  (!@ ¼‚€œ„€$ŒE™€H$„t ų ¼$$’’Ž€‚T@ ! 0!$$B@ ™@(! ų 0!¼™€'9MX ų @ !¼(! ų 0!¼Že @ !'¦$ Æ¢™€'9_Ü ų ¼æ8³4²0±,°(ą'½@<'œį™ą!'½’ĄÆæ8Ƶ4Æ“0Ƴ,Ʋ(Ʊ$ư Ƽ‚€'³$Tfl(!`0!$€Č! ų €Ø!‡Ā4¼‚€<ä$QMX° Č! ų 6Dlw ¼ Č! ų  !¼$ƒTÆ¢ d¢6ClwC$’’  !`0!$€Č! ų $‡Ā¼‚TB@¤ Č! ų ¼@ !(‚@ !‚€œÆ¤„€$™€HŒE ų $„”¼$’’!æ8µ4“0³,²(±$° ą'½@<'œß“™ą!'½žØÆæPÆ·LƶHƵDÆ“@Ƴ<Ʋ8Ʊ4ư0Ƽ€ø! °!Ą!˜!&sŒb@’ż$c*b@—$bÆ $$’’Æ¢,jÆ¢ ŒÄƒ|‚Œc@C!”B0B@)$Š‚TB@ '„(™@ ų 0!¼™€'9MX ų @ !@!™@ ų 0!@!,B¼@Æ£ ‚€œ„€$ŒE™€H5$„ø$bÆ£,&Ø!$$$’’Æ¢0UÆ¢ $ !$…€$™€üŽ$„Ų ų $@+¼&2SQ…€$Ž™€ø$„ ! ų  ˆ!@¼$Æ¢ …€$™€ø ! Č! ų $„Ü@¼ Æ  ‚€œ„€$ŒE™€H$„ą ų 3¼&BS*@0$’’£ '¢,T!ØCøC ™€™€ŽÅ'¢$ą !'¦,$'9i ų Æ¢@¼‚TB@¤$™€'9MX ų Œ„¼Œ‚„€$™$„ ų @(! ¼™€ŽÅą !'¦,'9cÄ ų $¼!$’’æP·L¶HµD“@³<²8±4°0ą'½X<'œÜÄ™ą!'½’ŠÆæ(Ʊ$ư ƼŒŠ€ˆ!…€$™€ø$„ ų  !@¼$’’™€\ ų  !¼ !…€$™€($„0!'9„  ų @8!s¼…€$™€($„'¦'9§l ų $@j¼“¢@—¢„€$™\ ų $„,¼—¢@U“¢„€$™\$„@ ų  €!—¢0B@¼„€$™\Č! ų $„T¼—¢0B@—¢„€$™\Č! ų $„l¼—¢0B@—¢„€$™\Č! ų $„¼—¢0B@—¢„€$™\Č! ų $„°¼—¢0B@—¢„€$™\Č! ų $„Ģ¼—¢0B @—£„€$™\Č! ų $„܏¼—£0b@“¢A„€$™\$„菄€$™\$„ Č! ų ¼“¢@—¢@!„€$™\ ų $„(¼!æ(±$° ą'½0<'œŚ`™ą!'½’°ÆæHƳDƲ@Ʊ<ư8Ƽ™€Š €!€˜!(!'¤Ą! ų $ ¼Ž…€$™€ø$„D ! ų  ˆ!@¼ŽP‡…€$™€ø$„P Č! ų  !@¼k$…€$™€ø ! Č! ų $„T@v¼a$…€$™€ø$„` Č! ų  !@d¼ŽD€j$’’™€ģ ų '„)@d¼ŽPa&R…€$™€ø$„P Č! ų  !@ ¼…€$™€ø$„p Č! ų  !@¼*…€$$$ŽD€IÆ¢™@(!0! ų  €!ŽD¼€@Æ¢™@(!Č! ų 0!ŽD ¼Æ¢$€6&Q ™@(!Č! ų 0!Ž$¼€Æ¢ ™€ģ ų '„/@¼'$’’™€ø$„T ! ų  ˆ!@¼ $…€$™€ø ! Č! ų $„|@¼$Æ¢…€$™€` !$„X'¦'9cÄ ų $  ¼„€$™$„ˆ ų (!¼!$’’æH³D²@±<°8ą'½P<'œ×¬™ą!'½’˜Æædƾ`Æ·\ƶXƵTÆ“PƳLƲHƱDư@Ƽ‚€ €!$QflĄ˜!$u'¦$Æ  Č! ų Ƥh@Ø!@¢¼¢@‚€ „€$Ž™E$„¤…€$ŒR™¤$„“ ų @ !¤h$@0! Č! ų $ A¼Š@Ø!ŠCŠDŠEŠF šCšDšE šFŽb&tÆ£Ƥ Æ„$@Ʀ(„€$™\ ų $„ȏ¼'°‚€'²,$Q‚€$$SąŽ™ (!` ! ų &&1g¼’÷Žž€$—€$–€$Æ£,Ƥ0Æ„4;Ʀ8Ž„€ ™@„€$™$„ų(! ų $’’R¼(! ų 0!¼@˜!‚€$™€ø !$E ų  ˆ!@¼ Ƴ,™€ø ! Č! ų 'Å@¼Ƴ0™€ø ! Č! ų &å@¼Ƴ4™€ø ! Č! ų &Å @¼Ƴ8„€$™’Ī$„$&”ސ’$™¤$„“ ų @ !¼™€\ ų @ !B!¤,$C¼„0¦4§8ØdødØeøeØføf Øg øg™€¤h@0!$'9_Ü ų $ ¼ !æd¾`·\¶XµT“P³L²H±D°@ą'½h<'œŌ€™ą!'½’pÆæŒÆ¾ˆÆ·„ƶ€Æµ|Æ“xƳtƲpƱlưhƼ™€ š!ĄØ!$u'¦$Æ '9fl ų €ø!@"¼‚TB@¤™€'9MX ų ¼€!@ Æ¢‚€œ„€$™€HŒE ų $„ūŌ ¼…€$ް™€ø$„D ! ų  ˆ!@¼…€$™€ø ! Č! ų $„P@¼$‚€œ„€$ŒE™€HN$„\$Ž¢@ &³$Ā­™€(™€('9†ų ¼ē$’ž™€Š'¤ (! ų $D¼޲…€$™€ø$„p@ ! ų  ˆ!@ !@ ¼…€$™€ø$„x Č! ų @ !@,¼Žp)…€™€ø$„ōÜ Č! ų  !@$¼…€$™€ø$„€ Č! ų  !@¼…€$™€ø$„6ų Č! ų  !@¼…€$™€ø ! Č! ų $„ˆ@¼‚€œ„€$ŒE™€H$„” ų ’¼¼$`ˆ!$ …€$™€ø$„Ģ@ ! ų  €!@ ¼…€$™€ø$„ŠČ! ų @ !@¼$ $Ā*€*™€…€$™€ø@ ! ų $„x@1¼ 0!!$cŒĀ@’ż$Ę,b@’‹™$$@'±Žd§¢" (!0! ų  €!§¢ ¢€B@j¼™$Žd (!Č! ų 0!£¢`¢€B@_¼™$Žd (!Č! ų 0!@Ø!¢€B@T¼Žp …€$™€ø$„€ ! ų  ˆ!&s @¼ !…€$™€ø$„ˆ Č! ų  !@¼ $ …€$™€ø ! Č! ų $„Ō@6¼$`…€$Žp™€ø$„ä ! ų  !&q@¼ ˜!…€$™€ø !@Č! ų $„ģ@!¼$™$'²Ž$@(!0! ų  €!@(!¢€B@¼2¢’$’€@0„’C%(ĄŽ$™$‚%e(%£„)£¢(£ *@(!Č! ų 0!§¢,¢€B@ž¼™$Ž$ @(!Č! ų 0!@!¢€B@ó¼$b™$—¢,$€C%§¢,Ž$@(!Č! ų 0!§¢.¢€B@ā¼™$Ž$@(!Č! ų 0!Æ¢0¢€B@׏¼™$Ž$@(!Č! ų 0!Æ¢4¢€B@Ģ¼™$Ž$@(!Č! ų 0!Æ¢8¢€B@Į¼™$Ž$ @(!Č! ų 0!Æ¢<¢€B@¶¼™$Ž$$@(!Č! ų 0!Æ¢D¢€B@«¼™$Ž$(@(!Č! ų 0!Æ¢H¢€B@ ¼™$Ž$,@(!Č! ų 0!Æ¢L¢€B@•¼™$Ž$0@(!Č! ų 0!Æ¢P¢€B@Š¼™$Ž$4@(!Č! ų 0!Æ¢T¢€B@¼™$Ž$8@(!Č! ų 0!§¢\¢¼€B@s&$8™$Œ„@(!Č! ų 0!Æ¢X@(!¢€B@g¼„€$™ ų $„ōR¼€™€ (!'¤ '9T€…€$™€ø@ ! ų $„x@¼ 0! !™€ (!'¤ '9U  ų :¼$cŒĀ@’ż$Ę,b@'±™€(žU'9įØ™$$@Žd§¢" (!0! ų  €!§¢ ¢€B@2¼™$Žd (!Č! ų 0!£¢(¢€B@'¼™$Žd (!Č! ų 0!£¢)¢¼€B@&d™$Œ„ (!Č! ų 0!£¢*¢€B@¼™€'° '9O€ ų  !¼Å™€ą !0!'9cÄ ų $D¼$’’æŒ¾ˆ·„¶€µ|“x³t²p±l°hą'½ą$<'œĖT™ą!'½’€Ææ|ƾxÆ·tƶpƵlÆ“hƳdƲ`Ʊ\ưXƼ ‚€ …€$ŒR™¤Æ¤€$„@ ! ų Ą€!¼ ¤€™€$@0!'9fl ų $ @¼ ŠBŠCŠDŠE ŠFŠGšBšCšD šEšFšGŽ&Æ¢(Æ£,Ƥ0Æ„4Ʀ8 Ƨ<„€$™\ ų $„$¼ '°(‚€'²@$Q‚€$$S4–’’’’™Æ¤ (!Ƣƣ` ! ų &&1’ń¼ Ļ!…€$™€ø$„ ! ų  €!@#¼ …€$™€ø$„Č! ų  !@¼ $…€$™€ø$„Č! ų  !@¼ $…€$™€ø$„ Č! ų  !@¼ $„€$™$„d!Ą@b#'¢(b !¢(ž€$Æ¢@¢,—€$Æ¢D¢0–€$Æ¢H¢4&uÆ¢L¢8Æ¢P¢<eÆ¢Tޤ€™@„€$™$„ų ų  (!Y¼ (! ų 0!¼ @˜!‚€$™€ø !$E±0‚T—¤B°± ²$@“(™€'9M@ ų ¼@°!‚€$SMX`Č! ų  ! !`Č! ų @Ø!@ !`Č! ų @ˆ!€ !`Č! ų @€!¼@ !€°!Ø!€ !@€!§¶„ü¢Ƥ(ư$Ʊ Ƶ·!ØbøbØuøuØqøq Øp øpØdød¢0&÷$BÆ¢0±0 ‚€œ…€$†€$ŒD™$„¼ ų $ĘŌžę¼‚TB@ ¤,‚€$RMX@Č! ų  !@Č! ų @€!¼@ˆ!€€!£ü¤ųƱ0d!ư,¤8£4ØPøPØQøQØCøC ØD øD™€¤0¦üą8!'9_Ü ų $¼æ,¾(·$¶ µ“³²± °ą'½0<'œV(™ą!'½’ÆæäÆ¾ąÆ·ÜÆ¶ŲÆµŌÆ“ŠÆ³ĢÆ²ČÆ±ÄưĄÆ¼ŒĀƤč@7$ÓŒ¢@Ą…€™€($„·ō'9©H ų '¦ @ŗ¼£ `„€$™\ ų $„Ģ¼0b’Ba0e‚€$$Gø‚€$$GĢ0b€@„€$™$„ä ų 0!¼Ÿ!0¢@‚€$$F d‚€$$Fȏ„€$™Æ§$„(B ų 8!’ī¼…€$'°$™$„, !ž€$ ų 0!¼ø! !ˆ!°!R!$b{ƒ°3$rµ,“¢2@¢ø±“™€ø ! ų 'Å8@¼ $ ‚€œ…€$†€$ŒD™$„<$Ę, 8!@€Æ¢ø¢ø$0BB%$m$s“¢2@ ‚€œ…€$ŒD§“™$„„†€$$Ę, ų K¼ ¢ø‚€œ…€$ŒD™?$„h$0B4B€€“¢2@¢ø‚€œ…€$ŒD§“™’ć$„°$0B’B%€b˜!™0ą ! ų `(!@!$’’b’؏¼Ą !€ 2C,b@!$ b$!R% …€€ ™™€(¤č$„·ō'9¦D ų @0! ¼‚€œ…€$ŒD$„䏆€$ ų $Ę,¼$’’æä¾ą·Ü¶ŲµŌ“Š³Ģ²Č±Ä°Ąą'½č<'œR ™ą!'½’8ÆæÄÆ“ĄÆ³¼Æ²øÆ±“ư°Æ¼™'°¬Ą€ˆ!¬ą !Ą!0!ą˜! ų   !¼ !™0 ų  (!@!$’’b5¼“¢%@3 !$b(ƒ£'$Cb™€ø…€$'±($„ ! ų  €!@¼…€$™€ø$„Č! ų  !@ ¼…€$™€ø !Č! ų $„@¼“¢&@ £ ‚€œ…€$™ŒD§Ø$„, ų €0!¼$’’¢¬ !®B®c !æÄ“Ą³¼²ø±“°°€!ą'½Č<'œQ,™ą!'½’ÆæąÆ³ÜÆ²ŲÆ±ŌÆ°ŠÆ¼“€$™€($Š€!&ep !'¦ '§$'9uĄ ų Æ  @ˆ!@¼£$€P!ŒP1™€\` '§(™€ą0!@ !$'9fl ų $$ ¼™€$$¦ @ !&ep'9g„ ų Æ¢¼@c@ˆ!‚TB@¤(™€'9MX ų ¼€!™€ą'°L@0! !'„, ų Æ¢(¼(!„€$™ ų $„xI¼ ų  !@!,B!@ ¼‚€œ…€$™ŒD$„Œ ų 0!¼9$’’™d'±,$f(!Æ£( ų  !¼'°L™€ą¦( (! ų  !¼(!„€$™ ų $„“¼‚TB@¤(™€'9MX ų ¼€!Æ¢(¢$@ '§(™€ą0!@ !$'9_Ü ų $$ ¼…€$™€$$¦ @ !$„p'9bx ų Æ¢¼@ˆ! !æą³Ü²Ų±Ō°Šą'½č<'œN“™ą!'½’øÆæ@Ƴ<Ʋ8Ʊ4ư0Ƽ“€$™€($Ń€!&eČ !'¦ '§$'9uĄ ų Æ  @€!@C¼£$€Q!ŒD€ ™€ģ` '§(™€ą0!@ !$'9fl ų $ ¼™€$¦ @ !&eČ'9g„ ų Æ¢¼@'@€!™€Č ų '¤(¼™\ ų @ !¼'°( ų (!@¼$’’¢$@ ™€™€@ !0!$'9_Ü ų $ ¼$¦ @ !&eČ8!'9bx ų Æ¢¼@€!!æ@³<²8±4°0ą'½H<'œM,™ą!'½’(ÆæŌÆ²ŠÆ±ĢÆ°ČÆ¼™€ŠĄ€!€ˆ!$¤'¤  !Æ  ų (!¼&…€$™€($„Š !'¦'9uĄ ų '§@4¼¢€€!Ž€-‚TB@ &™€p ų ¼™€'9MX ų @ !Ž™€p ų Ž¼€Æ¢ ™€ģ ų '„¼@¼¢@'¦ ™€ŽE  !$¤'9_܏…€$™€ !$„Ų$¤'9cÄ ų ¼$’’æŌ²Š±Ģ°Čą'½Ų<'œKŠ™ą!'½’ŲÆæ$Ʋ ƱưƼ€!„€$™€øŒÅĄ€! ų $„ä&b€ Ž ¼„€$™\ ų $„ģ¼ŽĄ‚€œ…€$ŒD™ $„™€P ! ų $=@¼‚€œ…€$ŒD™$„T0! ų ¼æ$² ±°$’’ą'½(‚€ ™¤ŒP (! ų  !¼™€\ ų  !¼@ !™€0!æ$² ±°$G$ '9_Ü '½(<'œJ™ą!'½’ČÆæ4Æ“0Ƴ,Ʋ(Ʊ$ư Ƽ™€P ˜!$/Ą ! ų €!@€!@¼$Q™$ !'„ ų $ @!¢€B@(¼‚€œ…€$ŒD™$„  0! ų @8!¼™€\ ų @ !¼@€!$’’*@ ™d‚€œ…€$ŒD™$„ģ ų @0!¼$’’@(!` ! ų 0!¼p!! @®‘€#’ē`ˆ!æ4“0³,²(±$° `!ą'½8<'œIH™ą!'½’ĄÆæ8Ƴ4Ʋ0Ʊ,ư(Ƽ€ …€$™€¤$U$„0$$ Æ¢€˜!Æ  ų &J¼&J™\ ų <¼™H ų 6ü@ˆ!@ ¼‚€œ…€$™ŒD$„@ ų 6ü¼F$’’™€Š6ü(!@0! ų @ !¼` !…€$™€($„l 0!'9§l ų @8!@€!@$¼…€$™€($„p` !'9©H ų '¦ £ $’éb ¼™€` !@8!$'9fl ų  0!@€!@¼‚€œ…€$™ŒD$„| ų 0!¼™€< ų  !¼$’ž™€P ! ų $ @¼ @™\ ų  !¼™€< ų  !¼!æ8³4²0±,°(ą'½@<'œGh™ą!'½’ˆÆætƾpÆ·lƶhƵdÆ“`Ƴ\ƲXƱTưPƼ ™€Æ„|Ą!$u'¦($Æ ('9fl ų Ƥx@°!@Ż¼ ‚TB@¤(™€'9MX ų ¼ @ˆ!€ˆ!ŽPĶ&S…€$™€øÆ±($„  ! ų  !@¼  ø!…€$™€ø !@Č! ų $„¤@ŗ¼ $ ą ‚€ ‚€œ„€$ŒE™€H÷$„Øą‚€ …€$ŒD™¤$„Š…€$ŒD™¤$„Ü ų ¼ ¤x‚€ ™€ŒT¢|€0!ŒE'9fl ų $ @“¼ Š‚ŠƒŠ„Š… š‚šƒš„ š…Žq&rÆ¢,Æ£0Ƥ4 bÆ„8¢(@‚€$$E豏‚€$‚€$$Eš$E„€$™ ų $„ ¼ 'µ,‚€ø!$^ƒT’¤b’„@™€'9M@ ų £ %¼ @(!£(%’¢†€$0B`C™\$Ä ¢£W¢„ ų ¼ ’¢’²’±’°„€$B%™8!Ą(!$„@ 0!Ʋ ų  ˜!¼ 2„€$™1ą(!0Ę2'ư$„h`Č!Æ“ ų Ʋ¼ $„€$™€…($„’’&’’9@`Č! ų $„¬&÷$¼ &µā('Ž’µƒT…€$™€ø$„ ! ų  €!@¼ !…€$™€ø$„Č! ų  !@¼ $…€$™€ø$„Č! ų  !@¼  $…€$™€ø !Č! ų $„ @’¼ $'¢<€C˜!‚€ž€$$VM@¢,&UÆ¢<¢0Æ¢@¢4Æ¢D¢8ĖÆ¢Hޱ ė‚€$™€ø !$EŲ ų  !@0¼ ‚€$™€ō !$EÜ ų  €!@ ¼ ƒ€™€ō !Č! ų $eōÜ@¼ ’b4B‚€$™€ō !Č! ų $Eą@¼ ™€ō !Č! ų 'ÅK@¼ ’b0Bļš¢b‚€œ„€$ŒE™€H$„ä ų µ¼ ‚€$™€ø !@Č! ų $Eü@¼ ™$0! ! ų (!@0!$B’’,B@¼ ’b0Ć0Bšb%y¢c‚€œ…€$ŒD™$$„ $cÆ¢‚€$™€ø !@Č! ų $E $@¼ ™$0! ! ų (!@0!,B@¼ ’b0B‚€œ…€$ŒD™$$„ ,EÆ¢‚€$™€ø !@Č! ų $E L@¼ ™$0! ! ų (!@0!,B@¼ ’b0Ć0Bšb%<¢c‚€œ…€$ŒD™$$„ T&Æ¢‚€$™€ø !@Č! ų $E t@#¼ ™$0! ! ų (!4’’@0!b+@¼ ƒTb@0Ä’’ĄČ! ų ¼ @ !¢b¢d‚€œ…€$™ŒD$„ |Æ£8! ų .¼ ‚€œ…€$ŒD™$„Ü ų 0!%¼ &µް’4ą…€$™¤$„Š…€$™¤$„Ü ų € !¼ ™€\ ų € !Šd‚!šd$C¼ Ødød¢|™€ŒE ¤x€0!'9_Ü ų $ ¼ @°!$’’Ą!æt¾p·l¶hµd“`³\²X±T°Pą'½x<'œ?T™ą!'½’ĄÆæ<Æ“8Ƴ4Ʋ0Ʊ,ư(ƼŒŃ€˜!  ! $Ņ„€$™\8$„š`…€$™€ō$„ œ ! ų  €!@¼($…€$™€ō$„|Č! ų  !@¼$…€$™€ō$„„Č! ų  !@¼$…€$™€ō$„ˆČ! ų  !@¼ $„€$™$„   (! ų ¼3$’’ŽD€Æ¢„€$™\$„ Ä ų ’õ¼™€ģ ų '„@¼„€$ŽE™’č$„š”‚TB@¤™€'9MX ų ¼@ !‚€ ƤŒF™€ØÄøÄ¢$ĆØbøb“¢ ` ! b“¢!$  b'9_Ü ų Ž… ¼æ<“8³4²0±,°(ą'½@<'œ=X™ą!'½’ŲÆæ Æ±ưƼ€l€ˆ!&Ž™€ō !@@(!€! ų @’õ¼!æ ±°ą'½(<'œ<䙹!'½’ŠÆæ,Ʋ(Ʊ$ư ƼŒŃ 1€!™€$'¦'9fl ų $@€!@d¼‚TB@¤™€'9MX ų ¼@(!€(! Æ„„€$™\$„Ģ$¢$„€$™\$„ ų H¼¢™\„€$’ų$„܏„€$™ ų $„ ä=¼…€$™€ō$„Ģ ! ų  €!@¼Æ …€$™€ō$„Č! ų  !@¼ $…€$™€ō$„ÜČ! ų  !@¼$ Æ¢„€$™$„! ų  (!¼$’’‚TB@¤™€'9MX ų ¼€!™€@ !$Ž'¦$'9_Ü ų Æ¢¼@€!!æ,²(±$° ą'½0<'œ:虹!'½’ČÆæ4ƶ0Ƶ,Æ“(Ƴ$Ʋ ƱưƼ‚€ ŒĆ€°!  !ŒR`<$ÓŒ¢@¹$’’‚TB@$T™€'9MX ų $T¼™€®BŽ…Ą !@0!'9fl ų $ @¦¼‚TB@ŽD™€'9MX ų ¼€!•€$&Q˜! ®B ų ސ¼(!™@0! ų &¤ōŒ¼&sŽB !b+™€Č@…&1$Tb’ī!‚æ4Œ¢ @~$’’‚TU !™€'9MX ų !¼…€Žp™€ō®B$„’ø ! ų  ˆ!@ ¼…€$™€ō ! Č! ų $„@¼Ž… Ą !@0!O$ $T™€'9MX ų $T¼™€®BŽ…Ą !@0!'9fl ų $ @M¼‚TB@ŽD™€'9MX ų ¼@ !Ą@C#B!$P®D ų @¼„€$™Že ų $„!.¼ŽB&s$B®BŽb(!™€ģ@ !@&ŽB,BT@’菂TB@ŽP!™€'9MX ų  !¼®B8Ą@ā8#Ž… Ą !@0!$ē™€æ4¶0µ,“(³$² ±°'9_Ü '½8$’’!æ4¶0µ,“(³$² ±°ą'½8<'œ7„™ą!'½’°ÆæHƵDÆ“@Ƴ<Ʋ8Ʊ4ư0ƼŒŠĄ˜!  !=€Ø!Œ„ ©™€'¦$'9fl ų $@¤¼‚TR@—¤$™€'9M@ ų ¼++@‚€$‚€$$TĢ$Tȗ¢&—°(@—±*@ !‚€$RM@@Č! ų  !@Č! ų @˜! !@Č! ų @€!¼@˜! !„€$™Æ¢$„!<€(!`0! ų 8!¼q!Œ¢ @m…€$™€ō$„Ģ ! ų  ˆ!@¼ $…€$™€ō$„!\ Č! ų  !@¼$(§¢$™@'² § $ !@(!0! ų  ˆ!§¢&¢ €B@L¼Žd€I&p™@@(! Č! ų 0!§¢(¢ €B@?¼Ž€=$’’™@@(! Č! ų 0!§¢*¢ €B@2¼‚TR@—¤$™€'9M@ ų ¼€!§¢$@—¢&™€'9M@ ų @ !¼§¢&@—°(™€'9M@ ų  !¼!§¢(@—±*™€'9M@ ų  !¼ !™€Ž…   !'¦$$'9_Ü ų §¢*¼$’’æHµD“@³<²8±4°0ą'½P<'œ4l™ą!'½’ĄÆæ8Ƴ4Ʋ0Ʊ,ư(Ƽ“€$™€($Ń€!&eó” !'¦'§ '9uĄ ų Æ @€!@b¼£ €Q!ŒP(…€$`'§™€@ !ą0!$…'9fl ų $¼@€!‚TB@¤™€'9MX ų ¼€! Æ¢™€¦@ !'9h ų &e󔏼@€!;!™€L ų ¤5¼™€ō$„ą ų  !@¼ Æ ™$ !'„$ ų 0!Æ¢¢$€B@¼!$’’¢ @‚TB@¤™€'9MX ų ¼€!™€@ !$†'¦$'9_ÜÆ¢…€$™€¦§@ !$„ó”'9c$ ų ¼@€!!æ8³4²0±,°(ą'½@<'œ2h™ą!'½’°ÆæLƾHÆ·Dƶ@Ƶ<Æ“8Ƴ4Ʋ0Ʊ,ư(Ƽ™€($ŃŒ„€š!'¦ !'§'9uĄ ų Æ @€!@Ł¼£€"ˆ!Ž$€7'§ ` …€$™€(Ą !$„!d'9©H ų ą0!¼™€¦Ą !'9h ų $„!d¼@Ą@€!„€$™„ $„!p ų  ˆ!¢ @¼„€$™ Č! ų $„!x¼‚€ “€$$Qä&20Ž"£ C$@™Ž% ų &d"¼&12’õ™Ø ų $ ¼ƒ|€‚Œc@C!”B’€ 0B@&P䏙@(! ų 0!ŽŽŽd%Ž e%ŽEäd%Ž(e%d%'0c’’b$¼`[Æ¢ E¢ŽŽŽC%Ž D%ŽDäC%Ž(D%C%ø' !°!Æ  &ÖŒb@’ż$c !$ !€ @ˆ!&菙€ōŽ ų Ž%@ ¼£ &1Ž’üŽ$b%Ø!$€Æ£ ‚€ &$B’ī™€ō`)—¢"W$@%&R&”–*@’ą˜!  ¢‚€œ…€$ŒDŽ&™ ų $„!„7¼…€$@ § ™€(Ą !$„!d'9¦D ų ą0!¼™€¦Ą !'9c$ ų $„!d¼$@€!$€œ„€$™€HŽ$„!Ø ų  ˆ!¼Ž„€$™€H Č! ų $„!Ą¼‚€ $Q䏂€$&20$S!üŽ&Ž'™Ž`(! ų &12’ų¼™Ø ų $ ¼ €!!æL¾H·D¶@µ<“8³4²0±,°(ą'½P<'œ.d™ą!'½’ĄÆæ8Æ·4ƶ0Ƶ,Æ“(Ƴ$Ʋ ƱưƼ‚€ ŒŠŒR$ ®B€ ! ˜!®@ $я‚€œ„€$ŒE™€H$„"™€\ ų  !$B’ž,B@ ¼‚€œ…€$ŒD™$„"  ų 0!¼s$’’™¤(! ų &DŽ0 ¼‚€œ„€$ŒE™€H$„"< ų ’ļ¼…€$™€ō$„ ! ų  ˆ!@¼$…€$™€ō$„Ü Č! ų  !@¼$‚€œ…€$ŒD™’Ņ$„!®B‚TPŽD™€'9MX ų ¼€!®BŽB™€'9MX ų @ !¼®BŽB ™€'9MX ų @ !¼™€®B Že€ !@0!'9fl ų $ @ø!@"¼‚€–T•€$$TMX@€!˜! Ž€Č! ų @ !¼™@(! ų &¤óø¼&s&’Ń ŽB €Č! ų @ !¼b+@’ź™Ø ų $ ¼ą!æ8·4¶0µ,“(³$² ±°ą'½@<'œ+°™ą!'½’ČÆæ0Ƴ,Ʋ(Ʊ$ư ƼŒŠ !€˜!Œ„ X™€'¦'9fl ų $@S¼‚TB@¤™€'9MX ų ¼€!„€$™Æ¢$„"L ų @(!¼?!Œ¢ @;…€$™€ō$„Ü ! ų  ˆ!@¼<…€$™€ō$„ą Č! ų  !@¼<4B™$ !'„ ų 0!Æ¢@!¢€B@¼@‚TC%Æ¢‚TB@¤™€'9MX ų ¼€!™€ŽE ` !'¦$'9_Ü ų Æ¢¼$’’æ0³,²(±$° ą'½8<'œ)š™ą!'½’ČÆæ0Ƴ,Ʋ(Ʊ$ư ƼŒŠ !1€˜!™€Œ„'¦'9fl ų $@]¼‚TB@¤™€'9MX ų ¼@ !$’’‚Ƥ„€$™$„?€™„€$ $„Ģ$‚„€$$„"T„€$™$„"\ ų ¼™Ø ų $ ¼5!…€$™€ō$„? ! ų  ˆ!@¼$’’…€$™€ō$„Ģ Č! ų  !@¼ Æ …€$™€ō ! Č! ų $„"T@¼$’’$Æ¢‚TB@¤™€'9MX ų ¼€!™€ŽE ` !'¦$'9_Ü ų Æ¢¼æ0³,²(±$° ą'½8<'œ( ™ą!'½’øÆæDƾ@Æ·<ƶ8Ƶ4Æ“0Ƴ,Ʋ(Ʊ$ư Ƽ™€Š Ø!$(!ž€$ ų €°!¼X'·ŽĀ,B’@‚€œ…€$ŒD™$„"d`0!D$’™@` !ą(! ų 0!° ¼‚€œ…€$ŒD™$„"  ų 0!¼?$’’ƒ€$™€ü !$e d$ ų ˆ@@¼&Æ¢&1™|$Æ£°‚@D!”B0B @’ų&‚€$™€ō !$EÜ ų  !@¼™€ō !@Č! ų 'Å h@¼ 61€€ ‚€œ…€$ŒD™$„"Ģ0!`8! ų ’Ź¼ŽĀ$CĀ! Q®Ć޳`’§&µ!æD¾@·<¶8µ4“0³,²(±$° ą'½H<'œ& ™ą!'½žĄÆæ8Ƶ4Æ“0Ƴ,Ʋ(Ʊ$ư Ƽ™€Š'²Ą€!€Ø!  !@ !(! ų $Ž¼ &™€Ž…  !@0!'9fl ų $@€!@a¼‚TB@¤™€'9MX ų ¼€!™€`@(! ų '¤¼™Ø ų $ L¼…€$™€ō$„# ! ų  €!@ ¼…€$™€ō !Č! ų $„K@¼Ž…   !@0!1$™€,@ !'9 T ų `(!¼¦'¤8! (!ƒA$„0b$ ‚$„¦’öą ‚T‚€œ…€$™ŒDކ ų $„#¼‚TB@¤™€'9MX ų ¼€!Ž…   !'¦$Æ¢™€'9_Ü ų ¼@€!!æ8µ4“0³,²(±$° ą'½@<'œ#Ų™ą!'½żĄÆæ8Ƶ4Æ“0Ƴ,Ʋ(Ʊ$ư Ƽ‚€ŒĆ€Ø!$Yfl`$Ō$r'¦ ų $@€!@¼‚TB@¤™€'9MX ų ¼€!™€`@(! ų '¤¼™Ø ų $ l¼$G'¦ ų $@€!@e¼‚TS`¤™€'9MX ų ¼@€!€€!…€$Ž‘™€ōư$„#P ! ų  !@ ¼'¤ (!‚’’$’€C%$„ ‚’’°’ś$„ …€™€ō !@Č! ų $„”@¼`™€'9MX ų  !¼@€!  !$H'¦$ ư™€,'°€(!'9 T ų  !¼Ø!€B@$ch’ü!‚€œ‚TB@™€'9MX ų  !¼@@!  !0!$H$ÆØ™€'9_Ü ų ¼@€!„€$™€HŒE ų $„#T¼$’’!æ8µ4“0³,²(±$° ą'½@<'œ!L™ą!'½’ŲÆæ Æ±ưƼ…€$™€ō$„# €! ų €ˆ!@¼…€$™€ō$„8Č! ų  !@¼$ ™€p ų  !¼@æ ±°ą'½(<'œ ¼™ą!'½’ĄÆæ8Ƴ4Ʋ0Ʊ,ư(ƼŒŠ€˜! ! $я‚€œ„€$™€HŒE ų $„#ˆ¼?$’’…€$™€ō$„ą ų  !@¼Æ ™€p ų  !¼Æ¢Ž$$Æ¢€Æ  ™€,'9§ ų ¼Æ¢‚TP¤™€'9MX ų ¼€!Æ¢¢™€'9MX ų @ !¼Æ¢!™€'9MX ų !¼™€ŽE ` !'¦$ '9_Ü ų Æ¢ ¼æ8³4²0±,°(ą'½@<'œH™ą!'½’øÆæ@Ƶ<Æ“8Ƴ4Ʋ0Ʊ,ư(Ƽ€Ø!  !Ą!$Ӑ!&RŒb@’ż$cÆ @MÆ  …€$Žq™€ō$„ ! ų  €!@¼$…€$™€ō$„ÜČ! ų  !@¼ $…€$™€ō$„#PČ! ų  !@¼$ Æ¢ ™$ !'„ ų 0!Æ¢¢€B@v¼.B@u…€$Žp™€ō$„ ! ų  ˆ!@¼$…€$™€ō$„Ü Č! ų  !@¼ $…€$™€ō ! Č! ų $„#P@W¼$4Æ¢ £ $b‘T„€$™\ ų $„#°J¼’"@™€™€'9MX ų ` !¼@!™€Ž…  !'¦$'9fl ų Æ£ @€!@=¼’"¤@Ž‘™€'9MX ų ¼0F’’€!0†’’„€$™$„#Ü (! ų @8!(¼‚TP¤ ™€'9MX ų ¼€!Æ¢ ¤™€'9MX ų ¼€!™€Ž…   !'¦$'9_Ü ų Æ¢¼@€!$’’¢ @’Ŗ£ ’Ū‚T!æ@µ<“8³4²0±,°(ą'½H<'œ$™ą!'½’ØÆæTƾPÆ·LƶHƵDÆ“@Ƴ<Ʋ8Ʊ4ư0Ƽ š!Ą!$Ņ˜!ƤX&sŒb@’ż$c`É$’’™$ŽD'“€(!0! ų  €!@Ø!¢€B@·¼.b@“™$ŽD€(!Č! ų 0!@°!¢€B@Ŗ¼$w=Æ (…€$ŽP™€ō$„ ! ų  ˆ!@¼$ !Æ¢(…€$™€ō$„Ü Č! ų  !@¼ ! Æ·(™@ !€(! ų 0!@ !¢€B@…¼€ !$bƒ¢(…€$ŽP ™€ō$„ ! ų  ˆ!@¼ $…€$™€ō ! Č! ų $„Ü@n¼$;Æ¢(‚TP¤(™€'9MX ų ¼€!Æ¢(™€'9MX ų   !¼ !Æ¢™€'9MX ų Ą !¼Ą!™€Å¤X'¦$'9fl ų Æ¢$@€!@I¼‚TB@¤ ™€'9MX ų ¼€!„€$™$„"L ų @(!7¼‚TP¤(™€'9MX ų ¼€!Æ¢(™€'9MX ų   !¼ !Æ¢™€'9MX ų Ą !¼Ą!Æ¢$™€'9MX ų € !¼@ !™€Å ¤X'¦$'9_Ü ų Æ“ ¼@€!$’’@’“‚T’͐P!æT¾P·L¶HµD“@³<²8±4°0ą'½X<'œd™ą!'½’°ÆæHÆ·Dƶ@Ƶ<Æ“8Ƴ4Ʋ0Ʊ,ư(Ƽ€ø! °!Ą!$Ó !&”Œb@’ż$c€!$’’™$Žd'„ ų 0!@!¢€B@¼.‚Æ @]Æ  …€$Žp™€ō$„ ! ų  ˆ!@¼@€!Ø! $…€$™€ō$„Ü Č! ų  !@¼@€!Ø!$EÆ¢ …€$™€øŽÄ$„#š ų  ˆ!@1¼…€$™€ø$„#ü Č! ų  !@䏼…€$™€ø$„$ Č! ų  !@¼Ū6P …€$™€ø$„$ Č! ų  !@¼Ń6P0…€$™€ø$„$ Č! ų  !@¼Ē6P`…€$™€ø$„$  Č! ų  !@¼½6Pp™$ !'„ ų 0!Æ¢¢€B@°¼@€!Ø!.‚@Q£…€$Žq™€ō$„ ! ų  !@¼ $…€$™€ō !@Č! ų $„Ü@¼$:Æ¢ …€$™€øŽÄ$„#š ų  !@¼…€$Žq™€ø$„#ü@Č! ų  !@‰¼…€$™€ø$„$@Č! ų  !@¼6 …€$™€ø$„$@Č! ų  !@¼u60…€$™€ø$„$@Č! ų  !@¼k6`…€$™€ø !@Č! ų $„$ @^¼a6p£2’’Cˆ%$‚$‚6‚T¢ @‚T 1‚TP¤ ™€'9MX ų ¼€!Æ¢ ™€'9MX ų  !¼@ˆ!™€ŽÅą !'¦$'9fl ų Ʊ@€!@7¼‚TB@¤™€'9MX ų ¼0E’’0…’’„€$™ ų $„"L%¼P¤ ™€'9MX ų ¼€!Æ¢ ™€'9MX ų  !¼@ˆ!™€ŽÅ ą !'¦$'9_Ü ų Ʊ¼@€!$’’@€!’O$’Ÿ$!æH·D¶@µ<“8³4²0±,°(ą'½P<'œL™ą!'½’°ÆæHƳDƲ@Ʊ<ư8Ƽ…€$™€($Š€˜!$„?l !'¦$'§('9uĄ ų Æ $@ˆ!@z¼£(`€$’’Æ¢$€P!ŒP3…€‚TB@¤$™€'9MX ų ¼@!€!‚€ …€$ŒP™€($ ` !$„?l'¦$$Æ£$Æ¢'9¦Š ų ư@S¼‚TB@Ž™€'9MX ų ¼@ !€„€™\$„·<„€$™\$„$ ų >¼™€ō$„·< ! ų  ˆ!@¼$…€$™€ō$„$ Č! ų  !@¼ˆ!™$ !'„  ų 0!@ !¢ €B@¼$’’€ˆ!‚TB@ ¤$‚€$PMXČ! ų  !Č! ų @!¼@ˆ!€!…€$™€(` !$„?l'¦,$Ʋ,'9„  ų Ʊ0¼@ˆ! !æH³D²@±<°8ą'½P<'œč™ą!'½’ČÆæ0Ƴ,Ʋ(Ʊ$ư ƼŒŠ !€˜!Œ„$’’¢Q™€'¦'9fl ų $@€!@K¼‚TB@¤™€'9MX ų ¼€!™€LÆ¢ ų @ !:¼Œ£ $’’b5…€$™€ō$„Ü ! ų  ˆ!@¼$Æ¢…€$™€ō$„ą Č! ų  !@¼ Æ ™$ !'„ ų 0!Æ¢¢€B@¼‚TB@¤™€'9MX ų ¼€!™€ŽE ` !'¦$'9_Ü ų Æ¢¼@€!$’’!æ0³,²(±$° ą'½8<'œ<™ą!'½’øÆæ@Ƶ<Æ“8Ƴ4Ʋ0Ʊ,ư(ƼŒÓ™€($ŌĄ!€Ø! ˆ!€ !`(!'¦'§$'9uĄ ų Æ @€!@d¼¤$€ €Ž# $b™€š  ! (! ų @0!T¼€T!ŒP$’’Ž#bN€ '§ ™€(  !`(!'9©H ų ą0!¼™€¦  !'9h ų `(!¼@<@€!™€L ų ¤ 7¼Ž# b3…€$™€ō$„Ü ! ų  ˆ!@¼$Æ¢ …€$™€ō$„ą Č! ų  !@¼ Æ  ™$ !'„ ų 0!Æ¢ ¢€B@¼¢$@ § ™€(  !`(!'9¦D ų ą0!¼™€¦  !'9c$ ų `(!¼@€!$’’!æ@µ<“8³4²0±,°(ą'½H<'œ ™ą!'½’ČÆæ0Ƴ,Ʋ(Ʊ$ư ƼŒĀĄˆ!€˜!@ !„€$™\$„š`™€p@ ! ų  €!Ž$+¼€£¢„€$™\ $„$™€pČ! ų Ž$ ¼€£¢„€$™\$„$0 ų "¼™  ų @!¼@§¢‚TB@™€™€'9M@ ų ` !¼@!™€ŽE` !'¦$'9cÄ ų §£¼„€$Ž% ™ ų $„$H¼$’’æ0³,²(±$° ą'½8<'œ ø™ą!'½’hÆæ”ƾÆ·ŒÆ¶ˆÆµ„Æ“€Æ³|ƲxƱtưpƼ‚€$÷$$C,ŒB,$ĘŖāƦ`'¦Æ dƦledŗā$¢ä¢å$’’ ā*ąØ!$’’'¾  ā+¬ć8¬ć,¬ć0¬ć4¬ą<™€Š$BĄ !(!$@ ų Æ¢`¤d€V¼†€$™€ø ! ų $Å$@}¼‚€$™€ü !$E$ ų $@'¼™€P ! ų $=@€!@¼‚€œ…€$ŒD™$„$d&%E#(C@™d$?C0  ų Ą !‚¼@&*˜!‚€œ…€$ŒD™$„$ 0! ų ¼$’’„€$’#‚`b !™€\ ų  !,B¼@‚3‚€œ…€$ŒD™’é$„$ȏ¦`ŒŅ@‚€œ…€$ŒD™’ą$„%¹`'9ƹ`€! !˜!$™$„l@ ! ų 0!@ˆ!¢€T$sb ¼‚€$™€øĄ ! ų $Ep@¼$t™€\ ų @ !@0!,B!@¼‚€œ…€$ŒD™Ą$„Œ™d®¦&¤ ų @(!¼$tb†€$™€øĄ ! ų $Å%0@¼‚€$™€ø@ !$Ełh ų  €!@¼¢ +†€$™€ø@ !Č! ų $Å%<@¼$¢¢+‚€œ…€$ŒD™–$„%D‚€$™€øĄ !$E%„ ų  €!@6¼†€$™€ø@ !Č! ų $Å?l@ ¼‚€$™€ø@ !Č! ų $E%@¼$¢ *‚€$™€ø@ !Č! ų $E%˜@ ¼‚€$™€ø@ !Č! ų $E% @¼ $‚€$™€ø@ !Č! ų $E%Ø@¼$¢¢*‚€œ…€$ŒD™Y$„%¬$bb‚€$™€øĄ ! ų $EČ@ ¼™€ģ@ ! ų ą(!@¼‚€œ…€$ŒD™D$„%ģ$nb.†€$™€øĄ ! ų $Å& @ ¼‚€œ…€$ŒD™3$„&(®±,$ab‚€$™€øĄ ! ų $Ełh@ ¼‚€œ…€$ŒD™"$„&\®±0$pb†€$™€øĄ ! ų $Å%<@ ¼‚€œ…€$ŒD™$„&”®±4$hb‚€$™€øĄ ! ų $E&Ģ@ ¼‚€œ…€$ŒD™$„&Ōž÷@0!®±8$cb†€$'¤  !@ˆ!˜!.Ƥh™€øĄ ! ų $Å'@’õ¼;¢` ų ¼@°!°‚€$™€d$E'd  !‚€œ™ŒD‚€$ 0!@8!$E' ų ˆ!$@b ¼‚€œ†€$™ŒD$Å'h@8!$@ ų $’’ ¼¦–>&s‚"™$ !„h0!@’Õ&”$’’b ®³<‚€œ„€$ŒE™€H ų $„' ž±¼$ƹd¢`ŒQ žn¢`‚TQ ޤ™€'9MX ų ¼€!®¢ Ž¢,™€'9MX ų @ !¼®¢, Ž¢0™€'9MX ų @ !¼®¢0 Ž¢4™€'9MX ų @ !¼®¢4 Ž¢8™€'9MX ų @ !¼@ !‚€ €!$SM@! ®¤8 –@`Č! ų @ !¼¦@&R&ޤ<D*@’ō ™€'9MX ų ¼@ !®¤<!æ”¾·Œ¶ˆµ„“€³|²x±t°pą'½˜<'œp™ą!'½’°ÆæHÆ·Dƶ@Ƶ<Æ“8Ƴ4Ʋ0Ʊ,ư(ƼŒŠ °!…€$™€ō€ø!$„'Ą !Ą ! ų  ˆ!@¼…€$™€ō$„'Č Č! ų  !@¼ $„€$™(! ų $„'Š¼ˆ€!$•€$’€$$€ˆ! ų ¼ !™€ü&E'ģ@$  ų @¼& Ž0™$ !'„  ų 0!@ !¢ €B@¼‚€œ…€$ŒD™$„L0!0’’’&1Ž0™€ø&„Č’Ł !!™H ų $Č@ˆ!@ ¼‚€œ…€$ŒD™$„'ų$Č ų $’’J¼™€Š@ !(! ų $ȏ¼$ȏ™€,Ą(!€0!ą !&''9¼Ø ų Æ¢@€!@4¼‚TP$™€'9MX ų $¼®"™€'9M@ ų ` !¼@˜!¦3™€'9M@ ų @ !¼@!¦2Ž$D™€'9MX ų ¼@@$GH‚€ …€$ŒB™€(Æ¢$ ą !$„($ 0!'9”p ų Æ¢¼@€!™€< ų  !¼!æH·D¶@µ<“8³4²0±,°(ą'½P<'œt™ą!'½’ČÆæ0Ƴ,Ʋ(Ʊ$ư Ƽ™H€˜!$Ą ! ų Ą€!@ˆ!@ ¼‚€œ…€$™ŒD$„'ų ų $Ą¼,$’’™€Š@ !(! ų $Ą¼$Ą™€,0!` !@(! 8!'9¼Ø ų Æ¢@€!@¼‚TB@Ž$<™€'9MX ų ¼@@™€ŽE $G@` !'9_Ü ų  0!¼@€!™€< ų  !¼!æ0³,²(±$° ą'½8<'œ’4™ą!'½’pÆæŒÆ¾ˆÆ·„ƶ€Æµ|Æ“xƳtƲpƱlưhƼ'¢ €°! ø!'¾Æ `ĖÆ¢d¤d(! ų $@¤`&ր䏼‚€$™€ø ! ų $E$@ŗ¼‚€$™€ü !$E$ ų $@#¼™€P ! ų $=@€!@¼‚€œ…€$ŒD™$„(,&%E#(C@™d$?¤d ų C0 ‚¼@½&‚€œ…€$ŒD™$„(h ų  0!Ž¼„€$’#‚`bÆ !™€\ ų  !,B¼@‚0‚€œ…€$ŒD™’ė$„(°ŽŅ@‚€œ…€$ŒD™’ć$„(ų$b&֏‚€$™€ō¤d ų $EČ@ ¼™€ģ@ ! ų ą(!@h¼‚€œ„€$ŒE™€H[$„)4$c™€øą !@ˆ!>˜!‚€$¤d ų $E4p@’÷¼TŽŃ@ ‚€$™€œ$™ 0! ų $E)d%¼ ų ¼Š!™ Ą ! ų  @¼@!‚€$™€d  !` $E'd™€œ‚€$$™@8!$E) Ą0!$@b &”™€œ‚€$$™@8!$E)Č$@ ų ¼$’’ ų ¦ƒ ¼¢ˆ!&s‚€$™€  ! ų $E'd¼@€!"Ø!@0!™€ų (!Ą !’¾,B$’’b ®ó‚€œ„€$ŒE™€H$„* ų ¼'$’ž$Ƥ`ŽŃ ’4™€Š‚Tą€!R‚€ $SM@@– `Č! ų @ !¼¦ &1&Žä$*@’ō‚TB@™€'9MX ų ¼@ !!®ä !’i€!æŒ¾ˆ·„¶€µ|“x³t²p±l°hą'½<'œśō™ą!'½’ŲÆæ$Ʋ ƱưƼŒĀĄˆ!@ €!‚€œ„€$™€HŒE ų $„*$¼T$’’™H ų $Ž@€!@ ¼‚€œ…€$™ŒD$„'ų ų $Ž¼D$’叙€Š@ !(! ų $Ž¼Ž$™€ģ ų (!@ ¼‚€œ…€$Ž&™ŒD ų $„*@¼*$’žŽ"@&$$™€,'9É, ų (!@ˆ!@ ¼‚€œ„€$™€HŒE ų $„*p¼‚TB@Ž™€'9MX ų ¼@@$G™€@ !$5'9_Ü ų 0!¼@ˆ!™€< ų  !¼ !æ$² ±°ą'½(<'œł4™ą!'½’ŲÆæ$Ʋ ƱưƼ‚€  ˆ!ŒR…€$™¤€€!$„xģ ų @ !¼Ž%™€ !@0!'9fl ų $ @¼…€$™$„*œ@ ! ų  €!@¼ $…€$™$„*¤Č! ų @ !$$¼b( „€$™ ų $„ņ¼!æ$² ±°ą'½(<'œųD™ą!'½’ČÆæ0Ƴ,Ʋ(Ʊ$ư ƼĄ!Ą0 ˜!.¬Ą ų ¼@€!™€\@)` ! ų Æ  !€ƒ$=b!¼@$‘$ €!…€$™€ü$„ą ! ų $¼$™@$ b0  ! ų '„¼®B¢"!„€$™(! ų $„*¬¼ €!€ˆ!€!Ž"™`(!@ !@’Ģ&1!æ0³,²(±$° ą'½8<'œ÷™ą!'½’øÆæ@Ƴ<Ʋ8Ʊ4ư0ƼŒĀ€˜!@8$Š‚€,…€$$RŠ'±$$„*Ä !@Č! ų  0!@ ¼…€$¢$ !$„*Š 0!@Č! ų £¢ @¼„€$„€$™\$„*¼…€$™€¢$` !$„+'¦ $'9cÄ ų £¢!@ ¼1!™\$„*Č ų ¼*!„€$™\ ų $„*Ō¼#$’’…€$™€'¢($„+0!8!'9i ų Æ¢@¼!„€$™\ ų $„*ģ¼$’’°(„€$™’$„+  ų  ˆ!¼’„€$™ Č! ų $„+¼@!æ@³<²8±4°0ą'½H<'œõX™ą!'½’ĄÆæ<Ʋ8Ʊ4ư0ƼŒĀ€!@$Š…€$™€,'± $„+$ !'9Š ų  0!@¼¢ £¢(„€$™\ ų $„+¼…€$™€,$„+8 !'9Š ų  0!@¼¢ £¢)„€$™\ ų $„+0¼…€$™€,$„+L !'9Š ų  0!@¼¢ £¢*„€$™\ ų $„+D¼…€$™€,$„+` !'9Š ų  0!@¼¢ £¢+„€$™\ ų $„+X¼…€$™€,$„+t !'9Š ų  0!@¼¢ £¢,„€$™\ ų $„+l¼…€$™€,$„+ˆ !'9Š ų  0!@¼¢ £¢-„€$™\ ų $„+€¼…€$™€,$„+œ !'9Š ų  0!@¼¢ £¢.„€$™\ ų $„+”¼…€$™€, !$„+°'9Š ų  0!@¼¢ £¢/„€$™\ ų $„+؏¼…€$™€@ !$„+¼'¦('9cÄ ų $@¼T!„€$™\ ų $„+ȏ¼M$’’…€$™€'¢$$„+¼0!8!'9i ų Æ¢@¼!„€$™\ ų $„+č¼$’’°$„€$™’$„, ų  ˆ!¼’„€$™ Č! ų $„, ¼’„€$™ Č! ų $„,0¼’„€$™ Č! ų $„,@¼’„€$™ Č! ų $„,P¼’„€$™ Č! ų $„,`¼’„€$™ Č! ų $„,p¼’„€$™ Č! ų $„,€¼@!æ<²8±4°0ą'½@<'œńh™ą!'½’°ÆæHƵDÆ“@Ƴ<Ʋ8Ʊ4ư0ƼŒĀ€Ø!@¬$Š…€$™€,'³$$„, !`0!Æ ('9Š ų £ ,@¼ˆ!¢$$£¢(‚€,…€$$RŠ$„,œ !@Č! ų `0!@¼¢$$£¢)…€$ !$„,Ø@Č! ų `0!@¼¢$$£¢*…€$ !$„,“@Č! ų `0!@¼¢$$£¢+…€$ !$„,¼@Č! ų `0!@¼¢$£¢, …€$ !…€$™€$„-p  !'¦('9cÄ ų $§Ā€¼„€$™\$„,ȏ„€$™\$„,č ų ¼…€$™€,$„,ō !`0!Æ ('9Š ų £ ,@¼ˆ!¢$$£¢(‚€,…€$$RŠ$„- !@Č! ų `0!@¼¢$$£¢)…€$ !$„- @Č! ų `0!@¼¢$$£¢*…€$ !$„-@Č! ų `0!@¼¢$$£¢+…€$ !$„- @Č! ų `0!@¼¢$£¢, T€!…€$™€  !$„-ą'¦('9cÄ ų $§Ā€¼„€$™\3$„-,„€$™\/$„-L…€$™€'¢ $„-p0!8!'9i ų Æ¢A¼„€$™\ ų $„-X¼¢ „€$CEFGÆ£B™Æ¢ ų $„-x¼'¢ …€$™€  !$„-ą0!8!'9i ų Æ¢§Ā€¼„€$™\$„-Č ų ¼¢ „€$CEFGÆ£B™Æ¢ ų $„-č¼€!æHµD“@³<²8±4°0ą'½P<'œķX™ą!'½ž€Ææ|ƾxÆ·tƶpƵlÆ“hƳdƲ`Ʊ\ưXƼ‚€$ŒĆ”BH Ƥ€§¢ Æ„„Æ (`$Ņ‚€ '£8$U‚€,'¹,$TŠˆ!'¢H°!'³$'¾ Æ¢HÆ£LlƹP‚€ °!$R 'µH'¾,'·(Č'“ –¢Ž„¤H§£, ų §¢.–£`¼‚€$@ !$E.8€Č! ų `0!@½¼ø!ƒ€$@ !$e.@`0!€Č! ų §¢0¼@ˆ!$b$‚€$@ ! $E.Lb$‚€$@ !$E.Xb ø!‚€$@ !$E.d€Č! ų `0!¼@ˆ!ø! !¢$$™€č¤HÆ¢4 ų Ą(!°L@(!@ !`0!€Č! ų Æ $@ˆ!@Š¼!™€č¦ ! ų Ą(!&@’ļ¼ą¢„™€ŒE¤€¦P'9cÄ ų $@°!A¼„€$™\ ų $„.pr¼&µ–£$b’š™¤lĄ!–B’ś™¤ŽE’ü§£,  ! ų §¢.¼¢„™€ŒE¤€Ą0!$'9i ų Æ·@°!A ¼„€$–E’ų–™$„.Œ ų @8!N¼±(–"S=–"@$‚€$™–%$D.¤ ų  €!¼Ž%ƒ€$™$d.“Č!–C’śb$‚€$Ž%™$D.Äb$ƒ€$Ž%™$d.Ōb ™€č‚€$Ž%™$D.ä ų ¼™€č  ! ų €(!¼ €!„€$– ™@(! ų $„.ō¼ !™€č ų €(!&@’ó¼&R–C’ų$s’Ÿ&P’ųĄ!—¢&’C$—¢&’v$Ą!æ|¾x·t¶pµl“h³d²`±\°Xą'½€<'œé™ą!'½ž˜Æædƾ`Æ·\ƶXƵTÆ“PƳLƲHƱDư@Ƽ‚€$ŒĆ”BH Ƥh§¢ Æ„lÆ (` $Ō‚€ ˜!$Q,'¶8'¢2'µ '¾$'·,CÆ¢8‚€ ˜!$Q8‚€$'µ8$^.ō'·,'¶(u'“ –#–"Ž%§¤,§£0Ą ! ų §¢.¼Ą !™€č (! ų °8¼!™€,@(!€ !Ą0!'9Š ų Æ $@¼¢$$¦¦™€č ! ų  (!&@’ģ¼@¢l™€ŒE¤hą0!'9cÄ ų $ @˜!A¼„€$™\ ų $„/B¼&1 –$$‚’ŏ™¤<`!–#’ų–"’ö™¤Ž%’ü§¤,§£0  ! ų §¢.¼¢l™€ŒE¤hą0!$ '9i ų ƶ@˜!A ¼„€$–––%’ō™Æ¢ ų $„/¼°(–R™€č  ! ų €(!¼–™@(! ų Ą !¼ !™€č ų €(!&@’ō¼&1 –$’ō$’’Ē&0’ō`!æd¾`·\¶XµT“P³L²H±D°@ą'½h<'œęX™ą!'½’°ÆæLƾHÆ·Dƶ@Ƶ<Æ“8Ƴ4Ʋ0Ʊ,ư(ƼŒ¢ƤP@Ą€!™H ų $(@ !@ ¼‚€œ…€$™ŒD$„@ ų $(¼‰$’’™€Š@ !(! ų $(¼&‚€$ž€$$U/<—€$$<–€$£¢ $’’&Æ¢$Žq p@Č! ų @¼ Ø!™€ø !@Č! ų &刏¼ !™€ø@&Åļ$™€p ų &s¼ £¢ @Č! ų  !¼ !@S™€p ų ¼Æ¢$&s™€øŽp !'Å/P’Ö !…€$™€($(¤P$„/T'¦ $Æ¢'9¦Š ų Æ“@˜!@;¼…€$™€Ō$„/d ų   !@!@*¼•€œ–€$€ˆ! ų ¼@˜!™&Å/@0!P "ˆ!…€$ޤ@8!$„/h ų 0!¼$’’ ų ޤ¼’"’#C%$P™€|€ !$@8!@’į0!™€Ą ų @ ! ¼‚€œ…€$™ŒD$„/  ų  0!¼$’’™€< ų € !¼`!æL¾H·D¶@µ<“8³4²0±,°(ą'½P<'œćx™ą!'½üĄÆæ<ƾ8Æ·4ƶ0Ƶ,Æ“(Ƴ$Ʋ ƱưƼ™€ŠĄ€!Æ„D€š!(!'¤d ų $“Ž@ ¼‚€œ…€$ŒD¢D™ŒF ų $„/¼¼‚€ ¹DŒF‚€%$RflĄ !@Č! ų $@ę¼‚€(…€$$P©H$„/ŲĄ !Č! ų '¦(@ø!@L¼…€$Ą !$„/ąČ! ų '¦ @ø!@C¼—¶"™€X'±4 (!Ą ! ų  €!Ą !$'¦<@Č! ų $]@ø!@3¼™€X (!Č! ų Ą !¼@(!„€$™$„/ģ ų  €!“„<¼0¢Ą„€$1@™Ć0#Ā0!$„0Č! ų (‚“„T¼0¢Ą„€$1@™Ć0#Ā0!$„0$Č! ų (‚“„U¼0¢„€$Ą1@™Ć0#Ā0!$„0LČ! ų (‚¢(0B@¼‚€$$E0x‚€$$E0„€$™$„0¬ ų  €!¼„€$™Č! ų $„0Š¼‚TB@$™€'9MX ų $¼™€Ą !$¦'¦$$'9fl ų Æ¢$@ø!@¼‚TB@¤$™€'9MX ų ¼@ !0‚€@‚€$$B0ģ‚€$$B0ü™\Ƥ$ ų @ !¼“„V„€$0¢Ą1@Ć0#™(‚Ā0!$„1  ų  €!ƒ£–¼ƒØ—a`(!$e<€4Ii$a(ƒ$c’’$’üb%$c Ą@d#b0!8!% $a8ƒ$c’’$’üb%$c Ą@D#„€$C!™$„14Č! ų Æ¢¼'“<„€$™\ ų $„1d¼'²L„€$™Č! ų $„1€¼'°H‚€$$U1ˆ’™0¢Ą1@Ć0#Ā0!(‚  !& ˆ! ų €˜!’ņ¼„€$™ Č!’€$ ų $„1¼ &‘’’’0¢Ą1@Ć0#Ā0! ų (‚¼&™’ō&D1ˆ„€$™\$„1` ų  ˆ!2Ćš$ b¼“„o„€$0¢Ą1@™Ć0#Ā0!$„1œ(‚ ų  €!“„˜¼0¢Ą„€$1@Ć0#™Ā0!(‚Č! ų $„1ȏ¼$ ™Ø ų &rE¼„€$™\ Č! ų $„1ō¼„€$™Č! ų $„1€¼'°}‚€$$T1ˆ’™0¢Ą1@Ć0#Ā0!(‚€ !& ų  ˆ!’󏼏„€$™ Č!’€$ ų $„1¼'° &qN’’’0¢Ą1@Ć0#Ā0! ų (‚¼&™’ō&D1ˆ™Ø ų $ ¼'°W„€$™\ ų $„2¼&r„€$™ ų $„1€¼‚€$$T1ˆ’™0¢Ą1@Ć0#Ā0!(‚€ !& ų  ˆ!’󏼏„€$™ Č!’€$ ų $„1¼&q( '°[’’’0¢Ą1@Ć0#Ā0! ų (‚¼&™’ō&D1ˆŸ™Ø“„p„€$0¢Ą1@Ć0#™Ā0!(‚$„2  ų  €!¼„€$™\ Č! ų $„2H¼&qZ„€$™Č! ų $„2X¼'°Ž‚€$$T1ˆ’™0¢Ą1@Ć0#Ā0!(‚€ !& ų  !’󏼏™Ø ų $ ¼&q3„€$™\ ų $„2`¼'°g„€$™@Č! ų $„2X¼‚€$$R1ˆ’™0¢Ą1@Ć0#Ā0!(‚@ ! ų &’ō¼R™Ø¢DĄ !ŒE'¦œ@Č! ų $Č@ø!@¼‚T¤œB—± @—²¢™€'9MX ų ¼@€!‚€ !$QM@ Č! ų @ ! Č! ų @ !¼@ !€€!  !@ !2@2‚€$$Eó@‚€$$EóD2@‚€$‚€$$F2|$F2€§¤¢„€$™Æ°œ$„2„§“  ų  ˜!¼'°4™€X—¤ (! ų  ˆ!¼@(!„€$™`Č! ų $„2 ¼—¤¢™€X Č! ų (!¼@(!„€$™`Č! ų $„2ø“„¤¼0¢Ą„€$1@™Ć0#Ā0!$„2Ģ`Č! ų (‚“„„¼0¢Ą„€$1@™Ć0#Ā0!$„2ģ`Č! ų (‚“„®¼0¢Ą„€$1@Ć0#™(‚Ā0!`Č! ų $„3ƒ£¦¼ƒØ§a`(!$e<€4Ii$a(ƒ$c’’$’üb%$c Ą@d#b0!8!% $a8ƒ$c’’$’üb%$c Ą@D#„€$C!™$„3,`Č! ų Æ¢¼2–š„€$™\$„3\ ų  !¼:Š ‚€(.$Tx(! 0!€Č! ų '¤Ū¼$ ™Ø ų  ˆ!¼„€$™\@Č! ų $„3p(! 0!€Č! ų '¤¼™Ø Č! ų $ ¼„€$™\@Č! ų $„3€(!'¤5€Č! ų  0!¼™Ø Č! ų $   ¼„€$™`Č!’€$ ų $„3¼€! '±œe 0¢Ą1@Ć0#Ā0! ų (‚¼“¢Ø0!*™&D3¤@’ń&™Ø ų $ ¼“„©„€$0¢Ą1@™Ć0#Ā0!$„3¬`Č! ų (‚$ Ā¼“„­„€$0¢Ą1@Ć0#™Ā0!$„3Č`Č! ų (‚¼ąTą!¢D™€ŒEĄ !'¦d'9fl ų $“@ø!@H¼‚T¤dB—±h@—²j™€'9MX ų ¼@€!‚€ !$QM@ Č! ų @ ! Č! ų @ !¼@ !€€!  !@ !2@2‚€$$Eó@‚€$$EóD2@‚€$‚€$$F2|$F2€§¤j„€$™Æ°d$„2„§“h ų  ˜!¼'°,™€X—¤h(! ų  ˆ!¼@(!„€$™`Č! ų $„2 ¼—¤j™€X Č! ų (!¼@(!„€$™`Č! ų $„2ø“„l¼0¢Ą„€$1@™Ć0#Ā0!$„2Ģ`Č! ų (‚“„m¼0¢Ą„€$1@™Ć0#Ā0!$„2ģ`Č! ų (‚“„‚¼0¢Ą„€$1@Ć0#™(‚Ā0!`Č! ų $„3ƒ£n¼ƒØoa`(!$e<€4Ii$a(ƒ$c’’$’üb%$c Ą@d#b0!8!% $a8ƒ$c’’$’üb%$c Ą@D#„€$C!™$„3,`Č! ų Æ¢¼2–š„€$™\$„3\ ų  !¼:Š ‚€(.$TĄ(! 0!€Č! ų '¤ē¼$ ™Ø ų  ˆ!¼„€$™\@Č! ų $„3p(! 0!€Č! ų '¤L¼™Ø Č! ų $ ¼„€$™\@Č! ų $„3€(!'¤±€Č! ų  0!¼™Ø Č! ų $  T¼„€$™`Č!’€$ ų $„3č¼€! '±de0¢Ą1@Ć0#Ā0! ų (‚¼“¢p0!*™&D3¤@’ń&™Ø ų $ ¼€!„€$™’€$ ų $„4¼'±d ų e¼“¢p0!*™&D48@’÷&™Ø ų $ ¼€!„€$™’€$ ų $„4@¼ '±de 0¢Ą1@Ć0#Ā0! ų (‚¼“¢p0!*™&D3¤@’ń&™Ø ų $ ¼“„q„€$0¢Ą1@™Ć0#Ā0!$„3¬`Č! ų (‚$ Ā¼“„y„€$0¢Ą1@Ć0#™Ā0!$„3Č`Č! ų (‚¼ą!æ<¾8·4¶0µ,“(³$² ±°ą'½@<'œŃ0™ą!'½’ÆæäÆ¾ąÆ·ÜÆ¶ŲÆµŌÆ“ŠÆ³ĢÆ²ČÆ±ÄưĄÆ¼‚€™€ŠB˜Ąˆ!Ƥč(!'¤$£¢ ų  €!¼$ ‚€ ™€ŠŒS(!Č! ų ` !¼` !…€$™¤ ų $„4p¼` !™€\ ų &2@ !Ž"@‡¼…€$'°$™ !$„4h ų 0!¼š!ˆ!€!Ø!V'·$b̓£3$bb!¶,“¢2@$‚€œ…€$ŒD§“™ $„4|§øā $ā6" ‚€œ…€$ŒD™$„4¬†€$ ų $Ę4h±¼6"0Q’’ $0Q’’.$$wb$c“¢2@$‚€œ…€$ŒD§“™’č$„4ď§øā 6"$(ā6" ‚€œ…€$ŒD™’Ü$„4ų0Q’’$$cb€„“ ‚€œ…€$ŒD™'$„5™€ųą ! ų $¼£ €B!™0Ą ! ų @(!@!$’’b’¤¼ ‚€œT ‚€œ…€$†€$™ŒD$„58 ų $Ę4h b¼‚€œ…€$ŒD™$„5`†€$ ų $Ę4hX¼ˆ!T’@“!™€'9M@ ų  !¼@ˆ!“!™€ų&„¤Qd !'„ ų $’¼@&$d™€'9MX ų $d¼@!™€p!¤č¬C&”$'9fl ų `0!@š!@.¼‚€—T–€$$UMX&q!'“Ž$ Č! ų ¼0P’’0’’™€X ! ų €(!¼0!™&Ä5 ų €(!¼&R&1’šŽb Č! ų @ !¼B+@’į™Ø ų $ ¼$’’Ą!æä¾ą·Ü¶ŲµŌ“Š³Ģ²Č±Ä°Ąą'½č<'œĢ¼™ą!'½’ ÆæÜÆ¾ŲÆ·ŌÆ¶ŠÆµĢÆ“ČÆ³ÄƲĄÆ±¼Æ°øÆ¼ŒĀ Ø!€ø!@$ŅŒ¢@÷™€(Œ„'9©H ų '¦@€!@ń¼‚€ ™€XŒP—¤ ų (!¼¦„€$™(! ų $„5 ¼į€!™  ų @ !@ˆ!@Ź¼…€$'°™ !$„5¬ ų 0!¼š!˜!€!°!{ !$bɃ£+$cb¤$“¢*@‚€œ…€$ŒD§¬™]$„5ø§°(āį@'%‚€œ…€$ŒD™S$„5ģ0Q’’:$$bb$w“¢*@$‚€œ…€$ŒD§¬™C$„4|§°ā $ā 6" ‚€œ…€$ŒD™8$„4¬6"0Q’’A$0Q’’$b“¢*@$‚€œ…€$ŒD§¬™&$„4ď§°ā 6"$(ā6" ‚€œ…€$ŒD™$„4ų0Q’’$$$sb"€“¢*@‚€œ…€$ŒD§¬™ $„6§°$ā,B@ $’’‚€œ…€$ŒD™$„6<†€$ ų $Ę5¬\¼ā6"$ā6"6"0Q’’$€B!™0Ą ! ų @(!@!$’’b’¼2# $b6"0Q’’$Ą ‚€œ`€™€(+Ž„…€$†€$™ŒD$„6\ ų $Ę5¬` ¼‚€œ…€$†€$™ŒD$„58 ų $Ę5¬¼€ ‚€œ…€$†€$™ŒD$„5` ų $Ę5¬¼$’’‚€œ…€$†€$ŒD™$„6ˆ ų $Ę5¬¼™€(Ž„ą !'9¦D ų  0!@€!@ ¼„€$™$„6¼ ų  (!¼$’’!æÜ¾Ų·Ō¶ŠµĢ“ȏ³Ä²Ą±¼°øą'½ą<'œČP™ą!€!€!Ąƒ #‚ !™x  Ą<'œČ$™ą!'½’XÆæ¤Æ¾ Æ·œÆ¶˜Æµ”Æ“Æ³ŒÆ²ˆÆ±„ư€Æ¼‚€™€ŠB˜€˜!£¢,'¤- !Ą !(!$O ų Æ ¼„€$…€™€Ō$„6Ō ų $„č@€!@ ¼™l'¤,$O ų @0!¼™€Ą ų  !¼„€$™'°,$„6ä ų (!¼ !…€$™€ü$„6ō ų $,Q¼Æ  Æ  ™€` !$u'¦'9fl ų $@€!@܏¼¢@™€„„€$™\ ų $„6ü‚¼` !$''¦  ų $@€!@Ė¼Ž„€.™€p™€ŽE` !'¦'9fl ų $¼@€!‚TB@¤™€'9MX ų ¼@ !Ƥ€‚€ ™€XŒP0„’’ ų (!¼¦„€$™(! ų $„5 ¼¢€!€”!„€$™$„7(‚(! ų @!$bA¼‚TB@™€™€'9MX ų !¼™€ŽE ` !'¦$$'9_Ü ų Æ¢$@€! ¼@€!‚€,$PČ! ų $č¼Ø!‚€ž€$$Wfl‚€(!$V©H'“£ $` !$×$b€0!ĄČ! ų 'Å7D¼ąČ! ų ¼@€!$d@]&R Č! ų $dBW¼’ę£ $bP$’’ 9£ $b'±…€$™€($„7D 0!'9©H ų ` !@€!@A¼…€$™€(¦` !'9¦D ų $„/ą@€!@7¼„€$„™$„7P™€` !$× 0!'9fl ų $@€!@(¼™€` ! 0!$'9_Ü ų $@€!@¼„€$„™$„7l ų ¼™€ŽE` !'¦'9fl ų $@€!@ ¼¦Ą !…€$™€(` !'9¦D ų $„/ą¼@€!!æ¤¾ ·œ¶˜µ”“³Œ²ˆ±„°€ą'½Ø<'œĆX™ą!'½’ÆæōƾšÆ·ģÆ¶čÆµäÆ“ąÆ³ÜÆ²ŲÆ±ŌÆ°ŠÆ¼‚€ …€$ŒQ™¤€€!$„7„ ų  !¼ !™€$ 0!'9fl ų $ Æ¢Č@t¼‚TPŽ$™€'9MX ų ¼€!®"Ž"™€'9MX ų @ !¼„€$™Ž%®"$„7Œ ų @0!¼Ž2‚€&0M$TMX*B@Q‚TŠŠŠŠ ŠŠššš šššQÆ£,Ƥ0Æ„4Ʀ8Ƨ<ÆØ@ —¢.™€'9M@ ų @ !¼§¢. ¢0€Č! ų @ !¼Æ¢0 ¢4€Č! ų @ !¼Æ¢4 ¢8€Č! ų @ !¼Æ¢8 ¢<€Č! ų @ !¼Æ¢< ¢@€Č! ų @ !¼ƒ„,Æ¢@$&¢&U’菅€$ $„7ø$¢$…€$$„7Ą¢‚€$…€$$„7$™$D7Č ų “¢-¼0B@'¤H€€!ƒ€$™¤ ų $e7Ų¼'°P“¢-0B@“¢-'¢H‚€$™¤ ! ų $E7䏼&ƒ€$™¤ ! ų $e7č¼&“¢-0B@“¢-'¢H‚€$™¤ ! ų $E7䏼&…€$™¤ ! ų $„7š¼& “¢-0B@'¦H'¢Hƒ€$™¤ ! ų $e7䏼&…€$™¤ ! ų $„7ü¼&'¦Hƒ„-„€$™ ų $„8¼„€$™ ų $„8¼„0„€$™ ų $„80“¢-0B@’¼—„.†€$™€$0¢š„€$8B'9 h$Ę8@"0 ™$„8D0„’ ų  €!¼¦8„€$™„4Č! ų $„8X¼„<„€$™Č! ų $„8p¦@¦*@ ¼„€$™$„8„Č! ų  (!s¼ƒ£,$b$,Ā@c¢@Š$‚Tš$B@Ƥ€Č! ų ¼€!„€$™$„8ŠÆ¢b$,Ā@M¢@Š$‚Tš$B@Ƥ€Č! ų ¼€!„€$™Æ¢$„8ä ų @(!8¼b7¢@,Ā@4¢@Š"Š#Š$Š% š#š"š$ š%ž€$—€$–€$Æ£ Æ¢Ƥ$Æ„('³$!$’€™`(!&ä9@‚p&Ä9 (!$B0! ų ¼™`(!'Ä90 ų ¼’e’ų„€$™ ų $„9H&R$¼&sB’į!¢@"€!¢#@ž³¢Čæō™’$D9P¢Čæō¾š·ģ¶čµä“ą³Ü²Ų±Ō°Šą'½ų<'œ¼Š™ą!'½žČÆæ4Æ“0Ƴ,Ʋ(Ʊ$ư Ƽ  !…€$™¤'³ €ˆ!$„9l` ! ų Ą€!¼ !‚€$ö$Rfl'¦-@Č! ų $A¼„€$™\3$„ķøŽ%™€p ų  !0D’,ƒ¼`£¢3$’‚„€$™€Ž…  !`0!'9_Ü ų $A,¼„€$™\ ų $„9|&¼™Æ¢$„9¤(!0! ų $¼Ž… !`0!@Č! ų $A ¼„€$™\$„ķą ų ¼$’’ƒ¢ @‚€$‚€$$Eī$Eī„€$™ ų $„9䏼!æ4“0³,²(±$° ą'½8<'œ»™ą!'½’ĄÆæ8Ƽ$‚,B@(‚鏅€$™¤$„Ģ ų '¤¼@ 0‚…€$™€¤€0!$„: ų '¤¼@‚€$‚€$$G d$GČ7Ā…€$Ä0!™€¤$„: 0C ų '¤¼™\ ų '¤¼æ8ą'½@<'œŗP™ą!'½’ŠÆæ,Ʋ(Ʊ$ư ƼŒĘ€!Ą$ ˆ!‚€ ™¤ŒPŒ„ ų  !¼Ž%™€@ !0!'9fl ų $ @@¼‚TB@Ž™€'9MX ų ¼€!™€,@ !'9 L ų Æ¢¼-!‚TC‚€,` $Y§ ų Ą !¼™€'9MX ų @ !¼ ų Ą !¼@!‚€ Ž%ŒP™¤Æ£ ų  !¼™€\ ų  !£&¼ā8!Øćøć™€$ēŽ% 0!@ !'9_Ü ų š8#¼æ,²(±$° ą'½0<'œøČ™ą!'½’ Ææ\ƶXƵTÆ“PƳLƲHƱDư@Ƽ °!…€$™€¤Ą !ŒĘ€Ø!$„:'¤  ų  €!¼ކ…€$™€¤$„: Č! ų '¤)¼  !™€$'¦'9fl ų $@€!@œ¼‚TB@¤™€'9MX ų ¼€!™€  !$Œ'¦4$ '9fl ų Æ¢@€!@†¼‚T¤4B²8@³<‚€$QMX Č! ų @ ! Č! ų @€!` ! Č! ų @!¼@!€€!`!k*@ư4$Æ¢4…€$™€øŽ„Æ£<Ʋ8 ų $„_@!¼Ž‚@£™€ŽÅ  !'¦'9fl ų $@€!@R¼‚TB@¤™€'9MX ų ¼€!™€,@ !'9 L ų Æ¢¼?€!£`¢4$b $b6'°) Ž„(B@2$’’$B$'° B+$’’'°)Ž„€™€,™€((!  !'9©H ų '¦‡Ā¼¤€™€,„€$™\ ų $„Ģ¼'9 L ų ¼'9§ ų ¼(!™€(  !@0!'9¦D ų Æ¢¼@€!$’’!æ\¶XµT“P³L²H±D°@ą'½`<'œµˆ™ą!'½žŠÆæ,ƾ(Æ·$ƶ ƵÆ“ƳƲƱ ưƼ '¢(Œ„Æ¢‚€ ™€ŒB0!8!Æ¢ųÆ ,'9i ų €!@š!@ā¼ ¦('§0$ČĄˆĀˆĆˆÄˆÅ ˜Ā˜Ć˜Ä ˜Å$ʬā¬ć¬ä¬å Č’ņ$ēˆĀƒT˜Āq¬ā —¢0™€'9M@ ų @ !¼ @€!§¢0 —¢2™€'9M@ ų @ !¼ §¢2$„€$™$„:(0! ų $ ¼ ™€@ !$u'¦,'9fl ų $@š!@¼ ¤$’’‚TB@¤,™€'9MX ų ¼ €!Æ¢,‚€±ų$BÆ¢ü‚€'“Ō$VMX'¢ōÆ¢ƒTŽ„’`bސ’dŽ“’€@Ž•’„ĄČ! ų  !ĄČ! ų @ø!` !ĄČ! ų @!  !ĄČ! ų @€!¼ !€ø!`€! !…€$™€¤¦ü !ưą8!ƲÆ¢ ų $„:d¼ "ø!„TŽ‚’ ƒŽ’¤Ž‘’Ą`Ž“’ÄĄČ! ų @ ! !ĄČ! ų @Ø! !ĄČ! ų @!` !ĄČ! ų @€!¼ @Ø!!`! €!…€$™€¤@8!ưÆ¢ 0!ą ! ų $„:Øā!¢,@¼ ƒTŽ„’ąb@ ސ’äĄČ! ų  !ĄČ! ų @ˆ!¼ €ˆ!!@8!‚€$™€¤@ ! 0! ų $E:ģ¼ B!ƒTb@Ž„ĄČ! ų ¼ €!…€$™€¤@0!@ ! ų $„;Bˆ!¢ü£$B&”¼ ƒ’Æ¢ü…€$™¤ ! ų $„1`¼ ¤ų‚Œ™€H ų ŒE¼ Ą!æ,¾(·$¶ µ“³²± °ą'½0<'œ±T™ą!'½’PÆæ¬Æ“ØÆ³¤Æ² Æ±œÆ°˜Æ¼™€'¢ Œ„Æ¢‚€ 0!8!'9i ų ŒT@˜!@Ų¼¦ '§$$ČpˆĀˆĆˆÄˆÅ ˜Ā˜Ć˜Ä ˜Å$ʬā¬ć¬ä¬å Č’ņ$ē‚TQ —¤$™€'9M@ ų ¼@€!€€!§°$ —¢&™€'9M@ ų @ !¼§¢&$ „€$™$„;80! ų $¼¦$’’ ¢(™€'9MX ų @ !¼…€$†€$™€¤€ !$„;x$Ę;€ ų @8!¼‚€!‚TB@¤,™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę;ˆ ų @8!¼€!‚TB@¤0™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę; ų @8!¼€!‚TB@¤4™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę;œ ų @8!¼€!…€$™¤ ! ų $„1`¼&‚TB@¤8™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę;¤ ų @8!¼€!‚TB@¤<™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę;¬ ų @8!¼€!…€$™¤ ! ų $„1`¼&‚TB@¤@™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę;“ ų @8!¼€!‚TB@¤D™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę;¼ ų @8!¼€!‚TB@¤H™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę;Ä ų @8!¼€!‚TB@¤L™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę;Š ų @8!¼€!…€$™¤ ! ų $„1`¼&‚TB@¤P™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę;Ų ų @8!¼€!‚TB@¤T™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę;ą ų @8!¼€!‚TB@¤X™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę;ģ ų @8!¼€!‚TB@¤\™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę;ų ų @8!¼€!…€$™¤ ! ų $„1`¼&‚TB@¤`™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę< ų @8!¼€!‚TB@¤d™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę< ų @8!¼€!‚TB@¤h™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę< ų @8!¼€!‚TB@¤l™€'9MX ų ¼€!†€$…€$™€¤$Ę<(@8! ! ų $„;x¼€!’€$™¤ !&E1` ų  ˆ!¼&™¤ Č! ų &E1`¼€ !‚Œ™€H ų ŒE¼`!æ¬“؏³¤² ±œ°˜ą'½°<'œ©t™ą!'½żÆæōƾšÆ·쯶诵䯓௳ÜÆ²ŲÆ±ŌÆ°ŠÆ¼'¢ Œ„Æ¢‚€ ™€ŒB0!8!'9i ų Æ¢Č@š!@ ¼¦ '§$$Č ˆĀˆĆˆÄˆÅ ˜Ā˜Ć˜Ä ˜Å$ʬā¬ć¬ä¬å Č’ņ$ē‚TQ —¤$™€'9M@ ų ¼@€!€€!§°$ —¢&™€'9M@ ų @ !¼@ !.@ §¤&„€$™$„:(0! ų $¼ Ū$’’$ ™„€$$„:(0! ų $¼„€$™\ ų $„<4¼‚TB@¤(™€'9MX ų ¼€!…€$†€$™€¤¤Č$„;x$Ę;€ ų @8!¼£Čb€!‚TB@¤,™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę;ˆ ų @8!¼€!‚TB@¤0™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę; ų @8!¼€!‚TB@¤4™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę@8! ! ų $„;x¼€!…€$™¤ !$„1` ų  ˆ!¼&…€$™¤ Č! ų $„> ¼& ‚€–T$UMX‚€$'±Ø$Tóø'³$'²Ą’Ā@Ž$ Č! ų ¼€!™€¤ !@0! ų €(!&1¼€!2’ī`ø!…€$™¤ ! ų $„1`¼&‚TB@¤č™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę> ų @8!¼€!‚TB@¤ģ™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę>$ ų @8!¼€!‚TB@¤š™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę>0 ų @8!¼€!‚TB@¤ō™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę>< ų @8!¼€!…€$™¤ ! ų $„1`¼&‚TB@¤ų™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę>H ų @8!¼€!‚TB@¤ü™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę>T ų @8!¼€!‚TB@¤ ™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę>` ų @8!¼€!‚TB@¤\™€'9MX ų ¼€!†€$…€$™€¤$Ę<“@8! ! ų $„;x¼€!…€$™¤ !$„1` ų  ˆ!¼&…€$™¤ Č! ų $„>l¼& ‚€•T$TMX‚€$&ńō$Sóø'°’¢@Ž€Č! ų ¼€!™€¤@ !@0! ų `(!&¼’ļB!€$™¤&1`@ ! ų  ˆ!¼&1`™¤ Č! ų &D¼&P‚TB@¤™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę>x ų @8!¼€!‚TB@¤,™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę>ˆ ų @8!¼€!‚TB@¤™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę>” ų @8!¼€!…€$™¤ ! ų $„1`¼&‚TB@¤ ™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę>  ų @8!¼€!‚TB@¤™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę>¬ ų @8!¼€!‚TB@¤™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę>ø ų @8!¼€!…€$™¤ ! ų $„1`¼&‚TB@¤™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę>Ä ų @8!¼€!‚TB@¤™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę>Š ų @8!¼€!‚TB@¤ ™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę>Ü ų @8!¼€!…€$™¤ ! ų $„1`¼&‚TB@¤$™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę>č ų @8!¼€!‚TB@¤(™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę>ō ų @8!¼€!‚TB@±™€'9MX ų  !¼ !†€$…€$™€¤$Ę?@8! ! ų $„;x¼€!‘€$™¤ !&%1` ų  !¼&™¤@Č! ų &%1`¼&‚TB@¤(™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę? ų @8!¼€!‚TB@¤,™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę? ų @8!¼€!‚TB@¤0™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę?( ų @8!¼€!‚TB@¤4™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę?4 ų @8!¼€!…€$™¤ ! ų $„1`¼&‚TB@¤8™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę?@ ų @8!¼€!‚TB@¤<™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę?L ų @8!¼€!‚TB@¤@™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę?X ų @8!¼€!‚TB@¤D™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę?` ų @8!¼€!…€$™¤ ! ų $„1`¼&‚TB@¤H™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę?p ų @8!¼€!‚TB@¤L™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę?€ ų @8!¼€!‚TB@¤P™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę?Œ ų @8!¼€!‚TB@¤T™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę?˜ ų @8!¼€!…€$™¤ ! ų $„1`¼&‚TB@¤X™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę?¤ ų @8!¼€!‚TB@¤\™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę?° ų @8!¼€!‚TB@¤`™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę?¼ ų @8!¼€!‚TB@¤d™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę?Č ų @8!¼€!…€$™¤ ! ų $„1`¼&‚TB@¤h™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę?Ō ų @8!¼€!‚TB@¤l™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę?ą ų @8!¼€!‚TB@¤p™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę?ģ ų @8!¼€!‚TB@¤t™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę?ų ų @8!¼€!…€$™¤ ! ų $„1`¼&‚TB@¤x™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę@ ų @8!¼€!‚TB@¤|™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę@ ų @8!¼€!‚TB@¤€™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę@  ų @8!¼€!‚TB@¤„™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę@0 ų @8!¼€!…€$™¤ ! ų $„1`¼&‚TB@¤ˆ™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę@@ ų @8!¼€!‚TB@¤Œ™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę@L ų @8!¼€!‚TB@¤™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę@X ų @8!¼€!‚TB@¤”™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę@d ų @8!¼€!…€$™¤ ! ų $„1`¼&‚TB@¤˜™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę@p ų @8!¼€!‚TB@¤œ™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę@| ų @8!¼€!‚TB@¤ ™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę@ˆ ų @8!¼€!…€$™¤ ! ų $„1`¼&‚TB@¤¤™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę@ ų @8!¼€!‚TB@¤؏™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę@œ ų @8!¼€!‚TB@¤¬™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę@¬ ų @8!¼€!‚TB@¤°™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę@ø ų @8!¼€!…€$™¤ ! ų $„1`¼&‚TB@¤“™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę@Ä ų @8!¼€!‚TB@¤ø™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę@Š ų @8!¼€!‚TB@¤¼™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę@Ų ų @8!¼€!‚TB@¤Ą™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę@ä ų @8!¼€!‚TB@¤'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę@ģ ų @8!¼€!…€$™¤ ! ų $„1`¼&‚TB@¤ȏ™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę@ü ų @8!¼€!‚TB@¤$™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$ĘA ų @8!¼€!…€$™¤ ! ų $„1`¼&‚TB@¤4™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$ĘA ų @8!¼€!…€$™¤ ! ų $„1`—¢$¼,B@&‚TB@¤`™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę;“ ų @8!¼€!‚TB@¤d™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę;¼ ų @8!¼€!‚TB@¤h™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę;Ä ų @8!¼€!…€$™¤ ! ų $„1`¼&‚TB@¤l™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę;Š ų @8!¼€!‚TB@¤p™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę;Ų ų @8!¼€!‚TB@¤t™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę;ą ų @8!¼€!…€$™¤ ! ų $„1`¼&‚TB@¤x™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę;ģ ų @8!¼€!‚TB@¤|™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę;ų ų @8!¼€!‚TB@¤€™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę< ų @8!¼€!…€$™¤ ! ų $„1`¼&‚TB@¤„™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę< ų @8!¼€!‚TB@¤ˆ™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę< ų @8!¼€!‚TB@¤Œ™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$Ę<( ų @8!¼€!…€$™¤ ! ų $„1`¼&—¢$,B@‚TB@¤“™€'9MX ų ¼€!…€$†€$™€¤ !$„;x$ĘA ų @8!¼€!‚TB@¤ø™€'9MX ų ¼€!†€$…€$™€¤$ĘA,@8! ! ų $„;x¼€!’€$™¤ !&E1` ų  ˆ!¼&™¤ Č! ų &E1`¼¤ȏ‚Œ™€H ų ŒE¼Ą!æō¾š·ģ¶čµ䏓ą³܏²Ų±Ō°Šą'½ų<'œ|˜™ą!'½’ ÆæXÆ·TƶPƵLÆ“HƳDƲ@Ʊ<ư8ƼŒĀĄ€!€ø!@` °!™€Š'²$@ !(!$ ų  ˆ!Ž$0‚b¼‚&8Bxb€ ™€Š(!$ Č! ų @ !¼™€\ ų  !@!@x¼8B•|ˆ!@ !0S$p’’!0Bb’!’ !ƒC!&R ‚ E&’’&1’’*B@_‚$’’Ž¢@b!”c0b@W0b@ $‚’Š0b@™€T ų ¼$B’É$‚’É0E’,¢@’Ł&G$’’$’’D$’’*B@B !™€ŽÅą !'¦$'9cÄ ų $¼7@ˆ!‚€ ™€ŠŒD(! ų $ ¼ŽÅ™€'¢ ą !0!8!'9i ų Æ¢@ˆ!@$¼„€$™$„ą”€$ ų ² ¼$$P!€E ` ™0„’˜!™0„’ ų &„č“¼&’’$’’’īP!™Ø ų $ ¼$’’ !æX·T¶PµL“H³D²@±<°8ą'½`<'œyČ™ą!'½’øÆæDƶ@Ƶ<Æ“8Ƴ4Ʋ0Ʊ,ư(ƼŒĀ€°!@Œ$ŠŽ@‰‚€ ™€ŠŒU(!$  ų   !¼  !…€$™¤ ų $„A<¼‚TB@…€$™€'9MX ų !¼…€$Ž™€ŌÆ¢$„AH ų  !@ !@ ¼‚€œ…€$™ŒD$„AL ų  0!¼`$’ž™€Ü$$@8! ų &¤¼€ !™ ų @˜!&° @ ¼„€$™$„Al@(! ų  0!¼C$’ż™L ų € !@ ¼„€$™$„A„ ų  (!¼6$’ü‚TB@`! ˆ!‚€$RMX@Č! ų !` !@Č! ų @ˆ!¼@!¢Æ£ ƱŖŗŖŗ„€$Ŗ™ŗ $„Aœ`(!$  ų &g ¼8#™€€$ē ó8!Ą ! 0! ų $@€!A ¼‚€œ…€$™ŒD$„AĄ ų 0!¼™€Ą ų € !¼$’’!æD¶@µ<“8³4²0±,°(ą'½H<'œw(™ą!'½üHÆæ“ƶ°Æµ¬Æ“ØÆ³¤Æ² Æ±œÆ°˜Æ¼ŒĀĄˆ!€°! Ø!@$Ō‘$’’…€$™€Ō@ ! ų $„AH@˜!@ ¼‚€œ…€$™ŒDŽ& ų $„AL¼$’ž™€Ü'²$$@8! ų @ !¼` !™ ų @€!@ ¼„€$™Ž&$„Al ų @(!¼d$’ż™L ų ` !@ ¼„€$™Ž% ų $„AŲ¼W$’ü<HS£4BLFbޤ $‚£„€$™Ž% ų $„Aģ¼$’ū‚Œ™4 ų ŒDB¼$p’ģ2@‚€$P! @$p’ķ‚€$'²,$FB $‚ 2„€$™Ž% ų $„B,¼,$’ś@ ‚€$„€$™Ž%0! ų $„BP¼!$’ł$FBp„€$™Ž‡(!$„Bt ų  ˆ!¼‚Œ™4 ų ŒD¼Ž„ ™€8!Ą !'9_Ü ų @0!@€!A ¼„€$™Ž†$„B¤ Č! ų @(!¼™€Ą ų ` !¼!æ“¶°µ¬“؏³¤² ±œ°˜ą'½ø<'œth™ą!'½ż°ÆæLƾHÆ·Dƶ@Ƶ<Æ“8Ƴ4Ʋ0Ʊ,ư(ƼŒĀ$ĆĄ€!ƤPÆ„T@Æ£ ¬$’’…€$™€Ō@ ! ų $„AH@!¼@ Ž‚€œ…€$™ŒD ų $„AL¼š$’ž„€$™$„BÄ ų Ą(!¼‚Œ™4 ų ŒD¼‚TB@!™€'9MX ų !¼@!‚€žT$V_܏‚€—Œ$UMXˆ!€!'“'³ Æ£¹T% ĄČ! ų @ˆ!¼@!“Ā@™Ø Č! ų  !¼@!™ØÆ£ ų $.¼™4 ų Žä¼™€Ü` !@8!$ ų $$G¼€0!¤P@’Ū€!™@ ! ų  €!@ ¼™Č! ų @ !¼@ˆ!¢ „€$ŒE™3$„BŲ„€$™\$Æ¢ ų $„Bģ¼'³‚€–T$Ufl‚€$TMX¤P$’`0! Č! ų $@ˆ!¼A&’’$’’¤P’ō$’’Ā@¤€Č! ų ¼€!Æ¢£$b’ä$ ¦Ą ‚€œ„€$„™$„C  ų ¼…€$ŒD™ ų $„C8¼™€Ą ų @ !¼ !æL¾H·D¶@µ<“8³4²0±,°(ą'½P<'œq(™ą!'½’°ÆæLƾHÆ·Dƶ@Ƶ<Æ“8Ƴ4Ʋ0Ʊ,ư(ƼŒŠ ø!…€$™€ø‚€ $„C`€š! !Ą˜! ˆ! ų ŒT¼ !…€$™€ø$„Ch Č! ų @Ø!Žr@¼ģ$’’,VŽb &s@„€$™\ ų $„Cp¼3˜!™@@ !'„  ų 0!¼@€!˜!$UŖ¤®‚@X…€$™€Ō$„AH ų @ !@˜!@ ¼‚€œ…€$™ŒD$„AL ų @0!¼Ā$’ž™€Ü$$@8! ų &„¼` !™ ų @€!@ ¼„€$™$„Al@(! ų @0!¼¢$’ż™L ų ` !@ ¼„€$™$„A„ ų @(!¼•$’ü$ø$€–‚H$SrC–‚ˆC„€$™$„CŒ@(! ų $ø¼ƒ$’ū$ „€$™0!ƣƢ$„CĄ@(! ų $€¼t$’śK®€Ą ™@„€$™\ ų $„Cš¼˜!h$’ž'° @ !(! ų 0!¼®‚¢ €B@Ø! „€$ ų &¼¦"¢ €B@ &1„€$™$„D  ų @(!¼˜!J$’ł€ˆ!€!Žr™@ (!0!&s@’ē@ !Ž…0¢@„€$™ ų $„D$¼˜!6$’ų€@!,B@ „€$™$„DL ų $¼˜!)$’÷˜!®Ą&$U«™€®‚ŽåĄ ! 8!'9fl ų €0!¼’…„€$™$„ ų @€!¼„€$™Ž‡Žå $„Dhư ų  0!¼Žå ™€Ą !€0!'9_Ü ų  8!¼@€!‚Œ™4 ų ŒD`¼™€Ą ų ` !¼!æL¾H·D¶@µ<“8³4²0±,°(ą'½P<'œlØ™ą!'½’ĄÆæ<Ʋ8Ʊ4ư0ƼŒĀ ˆ!@*€!™€Œ„'¢(0!8!Æ¢'9i ų Æ (@ˆ!@0¼°('²$Æ $ ų &¼™\ ų @ !¼™€ä@ !(! ų $¼ !@’ń™”„(„€$™(#$„Dœ ų (ƒ¼™€¼'° @ ! ų (!@¼ $’’™€Ž%@ !0!'9cÄ ų $¼@ˆ! !æ<²8±4°0ą'½@<'œkl™ą!'½’ŠÆæ,Ʋ(Ʊ$ư Ƽ…€™€ä$„œ$ !€€! ų ‘@¼‚€$ $EDø…€™€ä$„  !@Č! ų $@/¼‚€$$ED¼ $„€$™$„DÄ" $„€$™$„DĢæ,²(±$°  '½0"„€$™’ö$„DŲ$"„€$™’š$„Dą$" 0!„€$™’é$„D菄€$™æ,²(±$° $„Dō '½0„€$’’’™Æ± ų $„Dü¼æ,²(±$° ą'½0<'œiü™ą!'½’°ÆæLƾHÆ·Dƶ@Ƶ<Æ“8Ƴ4Ʋ0Ʊ,ư(Ƽ‚€ …€$ŒS™¤Ą€!€š!$„E ų ` !Ž@4¼™€\` ! ų  €!¼@ !™€\Č! ų @ˆ!¼&0•€$B !qˆ!&·FÜ'¶ –¢Fܒć§¢ ££"’B&£¢ ’B&R ų £¢!¼¢"*™@Ą !(!$@* `’ė&1™€Ą !`0!8!'9_Ü ų $¼i@ø!™€Ą !$`0!'9fl ų $ @ø!@_¼‚TB@Žd™€'9MX ų ¼@ˆ!€ˆ!”€$&r€! ų €e¼*p!™&„č“@’ų&™Ø ų $ *"@¼’B$B"*@@˜!˜!*Ʊ$’e± $²F$¢$¢™֏„€$‚€$™\ ų $DE ’e,¢@¼3™„€$™$„EL ų  €!’e,¢@¼„€$™É$„EX’e „€$™$„E€±„€$™$„Eœ$²$’„€$™$„EØ $¢„€$™$„Eø$’„€$™$„Č! ų ’e,¢@ߏ¼™$„’’‚€$Ą$DE,‚€$™$DEŲ ų  €!’e,¢@¼„€$™”$„E䏂€$’t™$DFČ! ų €(!¼’~&rØ!k°!* @m™Ø ų $ ¼@ !‚€™€ä$Eœ$ ˆ! ų ’P@¼…€$ $„Dø™€ä™€@ !'%  Č! ų $@®¼…€$$„D¼$‚€$™$DF‚€$‚€$™$DL, ų ¼™0! ų $DDō¼$,™Ø ų  €!¼‚€$™$DF  ų  ˆ!¼™€,'9\ō ų &D¼™ØČ! ų $,¼&P‚€$™ Č! ų $DF$¼ !‚€™€ä$E¤ ų $@ ¼™™€$'$F( Č! ų ¼™€,'9\ō ų  !¼$ ™Ø ų &R ¼&µ&Ö Ö#“’”$P’ž„€$•(#™$„F, ų 0€¼H‚€$™(!*$DFT$„Fh ų  €!’e,¢@¼„€$™$„F„Č!’e „€$™$„E€±„€$™$„Eœ $²„€$™$„EØ$„€$™$„Č! ų ¼’e„€$™$„F° ų ¼„€$’f‘€$ ų $„Fď¼€! ų e¼’bp!*™&$č“@’÷&™Ø ų $ ¼™œ` ! ų '„$¼@˜!`žÖ$ ą!‚€$’E’F’G™Æ° ų $DDü’`¼ą!æL¾H·D¶@µ<“8³4²0±,°(ą'½P<'œbš™ą!™€ä <'œbŲ™ą!'½’ Ææ\ƾXÆ·TƶPƵLÆ“HƳDƲ@Ʊ<ư8Ƽƒ€‚$yUų$0C '¦$ƒ€…$b G”b $„§¢  ų £§"¼ $ƒ€…$bœG”bœ$„$„’ü§¢  ų £§"¼˜!@|—£$$bzæ\`„€$™\$„Fą„€$™\$„Fč ų ¢(@M¼„€$™$„Fš ų  ˆ!¼°(™€, !'„ '9ep ų $¼@3’,b@#€ƒ€$c¬C!ŒB\!@„€™\$„öX„€$™\$„G„€$™\$„ ų ų $¼„€$™\’ł$„ „€$™\’õ$„G „€$™\’ń$„G`‚€$‚€$$EG $EDø„€$™$„G$ ų `0! ¼„€$’’’™Æ£ Č! ų $„G8¼£,`\™bc„€$C!0R’’$„GX ų @(!¼ˆ!‚€,'“ $^ep‚€$$WDø‚€$$VG ‚€A$UÄ€C€!&€(!ĄČ! ų $¼@-’,b@"‚€$€U!ŒB\!@‚€$™$DGp‚€$™$DGx‚€$™$DG€ ų ¼‚€$™’ł$DGˆ‚€$™’õ$DG‚€$™’ń$DGœĄ(!™ó( `0! ų $DGØ ¼‚€$’’’™Æ£ ų $DG8¼&12’揢,™Ø ų $ ¼£0`L™bc„€$C!0R’’$„GĄ ų @(!¼ˆ!‚€,ž€$$Wep‚€$'“ $VDø‚€$2$UG €C€!&€(!ąČ! ų $¼@’`‚€$$b$b‚€$™™$DGŌ‚€$™$DGÜ'ÄGä ų ¼ (!™Ó( `0! ų $DGš ¼‚€$’’’™Æ£ ų $DH¼&12’Ī¢0™Ø ų $ ¼£4`_„€$bcC!0P’’™$„H$ ų (!` ¼2@‚€$‚€$$EČ$EH<„€$™ ų $„H@¼2@‚€$‚€$$EH<$Eȏ„€$™ ų $„HP2 ƒ` ¼$b $b $b $=‚€$$8$6$(!‚€$$Fȏ„€$™ ų $„H``¼20)  $¢ $¢ $¢ $%‚€$$ $$(!‚€$$Fȏ„€$™ ų $„Ht¼™Ø ų $ ¼`‚€$‚€$$EG $EDø„€$™ ų $„HŒ¼‚€$’Ģ$FōP‚€$’ä$FōPæ\¾X·T¶PµL“H³D²@±<°8ą'½`<'œ\™ą!'½’0ÆæĢÆ¾ČÆ·ÄÆ¶ĄÆµ¼Æ“øÆ³“Ʋ°Æ±¬Æ°ØÆ¼‚T€ !B@Œ„™€'9MX ų ¼8Bk8‚k,B@ ™€ą’„H$ ,…$e 4„ D%ŽƒT¦‚H$X®ƒx¦‚t'° ’† ! ų &…¼(!„€$™ ų $„€¼‚TB@–„™€'9M@ ų ¼€!0D$‚$‚€$$EH¬‚‚€$‚€$$EH“$EH¼„€$™ ų $„Hȏ¼‚TB@™€'9M@ ų –„N,¼,†…N„€$™$„HŌ ų  €!¼‚…P„€$™Č! ų $„H䒄`€(¼‚TB@™€'9M@ ų ¼0D’¢„`„€$™Č! ų $„Hō’‚`0B@¼„€$™Č! ų $„Hü¼’‚`0B@™Ø„€$™Č! ų $„I¼™Ø ų $ ¼‚TP Ž„™€'9MX ų $kC¼ ™€$k‚’‚Q@ ’…X™€'9M@ ų –„H¼0E’’…I„€$™ ų $„I¼™€Č ų &„¼@(!„€$™$„I  ų  €!¼„€$™Č! ų $„I,¼‚TB@–„™€'9M@ ų ¼@ !0‚@¦„„€$™ ų $„I<¼–‚0B@™„€$ ų $„ID¼–‚0B@™„€$ ų $„IL¼–‚0B@™„€$ ų $„IX¼–‚0B@™„€$ ų $„Id¼–‚0B @™„€$ ų $„Il¼–‚0B@@™„€$ ų $„Ix¼–‚0B€@™„€$ ų $„I€¼–‚0B@™„€$ ų $„IŒ¼–‚0B @™Ø„€$™ ų $„I˜¼™Ø ų $ ¼„€$™ ų $„I¤¼‚TB@Ž„4™€'9MX ų ¼€!™€`@(! ų &„8¼™Ø ų $ ¼‚TPŽ„x™€'9MX ų ¼++@K‚T–‚t™€'9M@ ų @ !¼‚°!Ž„x™€'9MX ų ¼@Ø!€Ø!‚€Ąˆ!$^Mģ‚€, !$Wep’.b@ &‚€&$EÜąČ! ų $¼@$&S!Q#C#@ˆ!!` ™€, !@(!ĄČ! ų $Ż@€!@’䏼™€'9eˆ ų  !¼™€Ą ! (!'9Mģ ų $0@¼™€,'9eˆ ų @ !¼‚TB@Ž„™€'9MX ų ¼8Bk8‚k+@Ÿ™Ø’‚Q@œ„€$™\ ų $„Iø¼‚TB@–„H™€'9M@ ų ¼@@!€@!1š$ b¦ˆH‚€$$EIĢ‚€$Eśō1 $ b8c$($$ C8 „€$™1’ÆØ$„IŠ ų  €!¼’…X„€$™Č! ų $„Iü¼„€$™Č! ų $„J¼‚TB@Ž„T™€'9MX ų ¼BB0B@‚T„€$™ ų $„J,¼‚TB@Ž„T™€'9MX ų ¼BB0B@‚T„€$™ ų $„J4¼‚TB@Ž„T™€'9MX ų ¼‚‚0B@™„€$ ų $„J<¼„€$™ ų $„JD¼<€’€$4Q€!™$(!&Dóø!&Ć‚!&aFd$c’’$’ųb%$cf0B@$€ ų ¼$€’菙„€$™\ ų $„jŠ¼™Ø ų $ ¼æĢ¾Č·Ä¶Ąµ¼“ø³“²°±¬°Øą'½Š<'œR¬™ą!'½’(ÆæŌÆ²ŠÆ±ĢÆ°ČÆ¼‚€$$Pfl'¦$Č! ų €!@ˆ!@C¼‚TC‚€ `ŒP$ ™€'9MX ų $ ¼™€®@ !$ˆ0!'9fl ų $ A¼V@ˆ!‚TސB@ &™€'9MX ų @!$lb¼™€,$l‚$k ™€,$kb ‚€œ™€,‚‚€œ™€,'9l` ų  !5¼…€$ŒDŽ™$„J\ ų $l,¼„€$™ ų $„J“@ !$'¦ Č! ų $$@ˆ!A¼™Ø ų $ ¼‚TB@¤ ™€'9MX ų ¼€!™€ą'°D@0! ! ų '„$¼(!„€$™ ų $„€¼ˆ! !æŌ²Š±Ģ°Čą'½Ų<'œPŒ™ą!'½’(ÆæŌÆ¾ŠÆ·ĢÆ¶ČÆµÄÆ“ĄÆ³¼Æ²øÆ±“ư°Æ¼™H<€°!6$ü ! ų Ą˜!@€!@ ¼‚€œ…€$™ŒD$„@ ų 6&ü¼ŽB8B3š+Ąd !Žd€ $€™$'„  ų 0!@!¢ €B@¼ū$’’`!•T™€Š'²$@ !(!$Œ ų @ˆ!’¢@¼™€'9MX ų  !¼@ˆ!…€$™€($ Ą !$„JÜ@0!$Ʊ(Æ¢'9¦Š ų ư@˜!@Ś¼’± Ž™€'9MX ų @ !¼® Ž™€'9MX ų @ !¼® Ž ™€'9MX ų @ !¼@ !Ž@ ® „€$™\ ų $„Jģ¼˜!®Ž$Ā’•,B@R‚€œ…€$™ŒD$„J\ ų $l˜!¼®H® ‚TB@6"ü™€'9MX ų 6$ü¼™€<Ą !4ēü$30!'9fl ų ®@˜!@‘¼‚TQ Ž™€'9MX ų ¼€!® Ž™€'9MX ų @ !¼® Ž™€'9MX ų @ !¼@ !Ž@®˜!®®Ž$Ā’•,B@ ‚€œ…€$™ŒD$„J\ ų $l¼®®˜!Ą‚T !B@Ž™€'9MX ų &¼@!€!&Ž‚@)ކ$Ā’•,B@ ‚€œ…€$™ŒD$„J\ ų $l¼‚€,—T$Vl`‚€& $UMXˆ!ĄČ! ų ’ā¼@Ž Č! ų ¼€!€!&1Ž‚"+@’ī !Ą#`!@™\$B$B $B™ „€$„€$™\ $„K„€$$„K„€$™\$„K4™\$„KL ų ¼„€$$„Kd ų @(!¼`!æŌ¾Š·Ģ¶ČµÄ“Ą³¼²ø±“°°ą'½Ų<'œKœ™ą!'½’ØÆæTƾPÆ·LƶHƵDÆ“@Ƴ<Ʋ8Ʊ4ư0ƼŒ°Æ„\…€$™€ø€š!Æ $$„K ! ˆ! ų Ą!@¼‚€  $VFŠ…€$™€ø$„K˜ Č! ų  !@¼‚€ $VFč°!™€'¢$(!Ą !0!8!'9i ų Æ¢@ ¼‚TB@¤$™€'9MX ų Œ„¼@(!Œ…ŽBÆ„(@&SØ! !F'· „€$™’€$ ų $„K ¼Ąˆ! !$@™&D" ų Ž%¼&1!Ž0’ō¢(™Ø ų $ p¼‚C$+b$-b$’’&R™@@ !ą(! ų 0!@!¢ €B@¼Ą€!Ž ų &@¼Ž™€ō ’ų@(!$€œ`ˆ!Žb€C$-b‘ %±Ø%&sŽr@’Ō‚T'D¢(b$€u%™€'9MX ų @ !¼£\™€ŒeĄ !'¦($'9cÄ ų Æ¢(.¼„€$™€HŽ$„KØ ų  ˆ!¼Ž„€$™€H Č!”€$“€$ ų $„Kš¼Ą!!"ŽG ų Ž¼Ž™ą0! ų &…L0¼&R !ŽQ™&eL$ ’ī 0!‚€œ™€ŒŒE ų $ ¼!æT¾P·L¶HµD“@³<²8±4°0ą'½X<'œH™ą!'½’øÆæ@Æ·<ƶ8Ƶ4Æ“0Ƴ,Ʋ(Ʊ$ư ƼŒĀĄ€!€ø! °!@m$ӏ™$@ !'„ ų 0!@ !²ŽB¼‚€ $QŽ$ ų &1@¼Ž0™€ō’ų@(!V€œ€€!.@Q$0B@LŽb@ ™H‚€œ„€$™€HŒE ų $„L8¼h$’’•T ų $Ø@ˆ!’¢@¼™€'9MX ų  !¼@€!™€Š&4®0€ !(!$¤ ų  !¼&0 ™€ģŽd ų (!@¼™€Š !(!@Č! ų $’¢¼@ Žd™€p ų ¼™€'9MX ų @ !¼™€p ų ¼®‚™€ŽÅ ą ! 0!'9_Ü ų $Ø)¼€œ„€$™€HŽ ų $„LP¼!‚€ ”€$“€$$Q$’’Ž' ų ŽD¼ŽD™ą0! ų &…L0¼&1!Ž0™&eL$’ī0!‚€œ™€ŒŒE ų $ ¼!æ@·<¶8µ4“0³,²(±$° ą'½H<'œEL™ą!'½’ŠÆæ(Ƴ$Ʋ ƱưƼ‚€Ģ ˜!…€$ŒF™$„L ų €€!¼(!™€Œ$  ų  !¼(!„€$™€H$„LŠ ų  ˆ!¼(!„€$™€H Č! ų $„M¼(!„€$™€H Č! ų $„M0¼(!„€$™€H Č! ų $„MT¼(!„€$™€H Č! ų $„M€¼(!„€$™€H Č! ų $„M¬¼(!™€Œ@Č! ų $ ¼ !™ `(!æ(³$² ±° '½0<'œD™ą!'½’ŲÆæ$Ʋ ƱưƼ€‚@€!™€\ ų @ˆ!,B@¼."@€lŽ&Ž™,@ !@ 0! ų Ž@’÷¼!€!!æ$² ±°ą'½(<'œCP™ą!'½’ Ææ\ƾXÆ·TƶPƵLÆ“HƳDƲ@Ʊ<ư8Ƽ€Ø!$  !Ą!$Š˜!Æ¢ &sŒb@’ż$c*b@ ‚€ ‚€œ…€$ŒDއ™$„MŌ ų `0!„¼ŒR`O¢@…€™€('±($„„Ų  ! 0!'9§l ų $ @€!@¼™€$'9„` ų  !@¼‚€$$BH¼ŒB„€$™§,Æ¢$„Mü'„( ų '¦0]¼…€$™€($„p  !'9©H ų '¦ £ $’ébR¼™€Ž…  !@0!'9fl ų $@€!@H¼‚B@™€$„€$™\ ų $„N ?¼'9„` ų @ !@¼‚€$$FH¼ŒF„€$™$„N ų @(!/¼…€$™€ōŽ$„ņ° ų  ˆ!@¼Ž$ ®B(®@ …€$™€ō$®S$„ Č! ų  !@¼®S…€$™€ō$„Ü Č! ų  !@ ¼…€$™€ō$„U  Č! ų  !@¼$ ®B„€$™$„! ų (!¼ū$’’®@‚TPŽD™€'9MX ų ¼€!®BŽB™€'9MX ų @ !¼®BŽB™€'9MX ų @ !¼®BŽD ™€'9MX ų ¼€!™€®B   !$@0!'9fl ų $ @€!@Ź¼„€$™\ ų $„N(¼ˆ!‚€žT$VMX‚€$—€$$U„`‚€$&S$TČ Č! ų @¼€0!ŒF™(! ų &äNX¼&1“Ā@ŽD ĄČ! ų ¼@!€!€b€!#+@’ä !›€!™€Š'±( !(! ų $ $’’$¼Æ“,b!Ž™€,'9‹ ų @¼ŒBˆC˜CÆ£(™€(Ž (!'9}Š ų '¦,@¼‚€œ…€$ŒDŽ™9$„N`£,$’’b:¢(7Æ¢0‚€('„0$R}Š@Č! ų '¦,@¼‚€œ…€$ŒDŽ™$$„NŠ™€,'9‹ ų Ž@¼ŒBˆC˜CÆ£(Ž (!@Č! ų '¦$@!¢$T¼‚€œ…€$ŒDŽ™ $„O4` £,‚€œ…€$ŒDŽ™$„O” ų ’=¼£,$’’b…€ƒ¢0@  !$„„Ų'¦($  !$„„Ų'¦($ ™€('9„  ų @€!@#¼…€$™€($„p  !'9©H ų '¦ £ $’éb¼£,$’’b‚€œƒ¢0@‚€œ„€$ŒE™€H ų $„OÜ ¼™€  !$T'¦('9_Ü ų $¼@€!!æ\¾X·T¶PµL“H³D²@±<°8ą'½`<'œ<€™ą!'½’ĄÆæ<ƶ8Ƶ4Æ“0Ƴ,Ʋ(Ʊ$ư Ƽƒ€$€ !$bFܐDސ”bF܏™€\£¤§¢ ! ų  ˆ!@0!$¼Ā&2$ Ā&$ Ā$ Ā$Ā$Ā$Ā$ Ā$"Ā$@Ā$BĀ|$’’ …€$™d®&@ !(! ų $Ę$¼…€$™,$„ą ! ų $@i¼&™€\ ų  !¼B'³ ®" ų ¼` !™@(! ų $¼¢B&R‚(!™€ų$` !@’ļ&Ž#$b $$ b$$b$$ bA$®"pŽ"t–€$•€$“€$4B%&2œ&ÄP@(! ų $@¼Ž#$b™, $™,&¤PD(! ų $@¼Ž#$b™,$®"p™,&dPH(! ų $@¼Ž"t$’żC$ ®"t™€ģ ! ų @(!@¼™€Š@ !(! ų $¼&”ސ’Ė™,!$’’æ<¶8µ4“0³,²(±$° ą'½@<'œ9 ™ą!'½žųÆæƾÆ·üƶųƵōÆ“šÆ³ģÆ²čÆ±äÆ°ąÆ¼™H$Æ¢(€ø!Æ  Æ $Æ ,$²Ąˆ! ų ŒŽ@°!@ ¼‚€œ…€$™ŒD$„PP ų $²¼ė$’叙€Š@ !(! ų $²¼Ž0ƒ€$b,”BŒc,¦Ā(Ų®Ć$™€\ ų  !@!,B!@я¼™d`0!(!®Ć ų &ď¼ą !…€$™€($„ó”'9©H ų '¦ A¼Æ  &4 WÆ Ų™€Š'¤0(! ų $¤¼ސ’ü‚€$™€ō !$EP| ų  ˆ!@¼ƒ€$™€ō ! Č! ų $eP„@ ¼‚€$™€ō ! Č! ų $Eo$@T¼Ž„€›$:€ƒb™€$€‚$B’ŠÆ¢Ų,B@ $‚‚€œ…€$ŒD™¦Ų ų $„Pˆ‰¼®‚™€$¢Ų€ !'„0'9‹ą ų Æ¢0@¼‚T¤0B°4± @²¤™€'9MX ų ¼ !™€'9MX ų @Ø!¼ !™€'9MX ų @˜!¼@ !™€'9MX ų @€!¼˜!€Ø! €!@!™€ą !$-'¦0$¤Æ¢¤Æ° Æ³4'9_Ü ų Ƶ0@O¼¢ 4B䯢 ‚€$™€ō ! Č! ų $EPØ@¼‚€$™€ō ! Č! ų $E%@ ¼‚€$™€ō ! Č! ų $Eś @O¼ސ ‚€$‚€œ…€$ŒD‚€Ģ™ŒF$„P° ų Ą8!%¼™€ō !$E%˜ ų  ˆ!@¼ƒ€$™€ō ! Č! ų $e% @ ¼‚€$™€ō ! Č! ų $EPų@¼„Æ (‚€$™€ō ! Č! ų $E?l@¼‚€$™€ō ! Č! ų $EQ@ ¼‚€$™, !$E% ų $@¼$ŠÆ¢(‚€œ…€$ŒD‚€Ģ™ŒF$„Qư ų Ą8!叼ƒ€$™€ō ! Č! ų $eQD@ ¼…€$™, !$„!h ų $@K¼ސŅ‚€$™€ō ! Č! ų $EQL@¼bÆ $‚€$™€ō ! Č! ų $EQT@¼$WÆ¢$‚€$™€ō ! Č! ų $EQ\@¼($…€$™€ō$„Qd Č! ų  !@¼$…€$™€ō$„Qh Č! ų  !@¼$…€$™€ō$„Qp Č! ų  !@¼ $@…€$™€ō ! Č! ų $„Qx@Ž¼$€$Æ¢,™€,@ !'9É, ų &Å$@€!@¼‚TB@ŽÄ,™€'9MX ų ¼@@$Q2‚€œ…€$ŒD‚€Ģ™ŒFŽ‚’ü$„Q€Æ¢ ų Ą8!i¼&”Ž‚’ü@žØ&’’ü$$‚TB@¤(™€'9MX ų ¼€!™€ą !$'¦($'9_Ü ų Æ¢(@€!@N¼‚TB@¤$™€'9MX ų ¼€!™€ą !$'¦$$'9_Ü ų Æ¢$@€!@8¼…€$™€(¦ $„ó”'9¦D ų ą !@€!@.¼‚TB@¤,™€'9MX ų ¼€!™€ą !$„'¦,$'9_Ü ų Æ¢,@€!@¼‚TB@ŽÄ™€'9MX ų ¼€!™€ą ! 8!$Ą0!'9_Ü ų ®Ā¼@€!$’ž™€< ų Ą !¼!æ¾·ü¶ųµō“š³ģ²č±ä°ąą'½<'œ1(™ą!'½’ÆæčÆ³äÆ²ąÆ±ÜÆ°ŲƼ ™€Š'±0Ą€!€!$¤ ! ˜!Æ ( ų (!¼ &…€$™€($„QØ !'¦('9uĄ ų '§,@]¼ ¢,€€!Ž€V™€p ų Ž¼ Æ¢0` &‚€œ„€$™€HŒE ų $„Q°G¼ ™€$'9‹ą ų  (!@A¼ ‚TP¤0™€'9MX ų ¼ €!Æ¢0¢4™€'9MX ų @ !¼ Æ¢4¢ ™€'9MX ų @ !¼ Æ¢ ¢¤™€'9MX ų @ !¼ Æ¢¤¢,@ '§0™€Že ą0!@ !'9_Ü ų $¤¼ $¤Æ¢‚€ …€$ŒB™€Æ¢¦($ @ !$„Ų'9aą ų Æ¢¼ $’’æč³ä²ą±Ü°Ųą'½š<'œ/™ą!'½’ČÆæ0Ƴ,Ʋ(Ʊ$ư ƼŒŠ !9€˜!™€Œ„'¦'9fl ų $@€!@ˆ¼‚TB@¤™€'9MX ų ¼@0!€0!,Ā@ ‚€$ƒ€€$cäC!ŒB\!@‚€$$EQ$ $E"\‚€$ $EQĢ‚€$$EQ܏‚€$$EQ菂€$$EQō„€$™Æ¦ ų $„RZ¼…€$™,$„ä !$ ų  ˆ!@¼8Æ …€$™,$„Ģ ! Č! ų $@¼ $…€$™,$„R ! Č! ų $@¼$!Æ¢…€$™,$„R ! Č! ų $@¼’ō$…€$™,$„R  ! Č! ų $@¼’é$™$ !'„ ų 0!Æ¢¢€B@¼‚TB@¤™€'9MX ų ¼€!™€ŽE ` !'¦$'9_Ü ų Æ¢¼@€!$’’!æ0³,²(±$° ą'½8<'œ,€™ą!'½’HÆæ“ƾ°Æ·¬Æ¶ØÆµ¤Æ“ Æ³œÆ²˜Æ±”ưÆ¼…€$™€'¢(Ąˆ!$„R$'¦,$ƢƠ Æ ('9i ų ƤøA…¼™€¤ø$'¦ '9fl ų $@ć¼‚TB@¤ ™€'9MX ų ¼@(!€(!Ž"Æ„ @&3‚€ ž€$$WGØ! !O'¶$„€$™ ų $„K ¼!‚€ ’€$ $QG$@™&D" ų Ž%¼&1!Ž0’ō¢ „™Ø‚C$+b$-b$’’&R™@@ !Ą(! ų 0!@!$’’b¼`ˆ!‚€œ™€HŒE ų 'ÄR0¼$¢$€B@ą€!ŽŽ ų &@¼Ž™€ō ’ų@(!=Ø!Žb€C$-b‘ %±Ø%&sŽr@’ɏ‚T'D¢ b$€u%™€'9MX ų @ !¼™€¤ø$'¦ $'9_ÜÆ¢ ‚T³(PŽb™€'9MX ų @ !¼®bŽb™€'9MX ų @ !¼@(!Ž"®e@&6'£$'¤W'„4'¹T !š!ø!Æ |Æ xÆ£€Æ¤„Æ„ˆŹÆ¹Œ  Žb„€$™$„Rd ų @0!¼!‚€ ’€$$QH8„€$™$„K  ų @(!’õ¼Žb$@™&D" ų Ž%¼&1!Ž0’󏂀 ’€$$QG !Žb$@™&D" ų Ž%¼&1!Ž0’󏙁Ø ų $  ¼‚Cb$-b$’’$’’&R™@„€@ !0! ų  Ø!@ˆ!$’’"O¼‚C$0b‚€œ‚C$xb‚€œƒ€$™€HŒE ų $dRp?¼„€$™€Š$…ą£”‚ą¤„££V$(! ų §¢T¼@ !™€\ ų  €!¼¤ˆ™€ų@(! ų $F’ų¼„€™@0! Č! ų @ !@ !¢$¼ @™€\Č! ų ¤ˆ¼¤Œ™ ų B(!¼„€™@@ !0! Č! ų @!‘¼ @ˆ!‚€œƒ€$™€HŒE ų $dR ¼ !ˆ!¢$€B@€ &GŽ ų &@¼$Ž™€ō ’ö@(!€ &H8Ž ų &@¼Ž™€ō€’ų@(!A$ !ŽĀ€C$-b„|€ ńø%Ōš%¹x“%D( 1Č%Æ„|ƹx&ÖŽŅ@’m$+ŽdŽc'('‚ $‚Te$¹|„xPy%…%®c®b™€'9MX ų @ !¼®bŽb™€'9MX ų @ !¼@!…€$Žb™€¤ø®c$„R$'¦,$Æ¢,Æ£0'9cÄ ų K¼€œ„€$™€HŽ$„KØ ų  ˆ!¼Ž„€$™€H Č! ų $„Kš¼!‚€ ”€$“€$$RG#ŽG ų Ž¼Ž™ą0! ų &…L0¼&R !ŽQ™&eL$ ’ī 0! ‚€œ‚€ ’€œ”€$“€$$QH8Ž' ų ŽD¼ŽD™ą0! ų &…L0¼&1!Ž0™&eR¼’ī0!‚€œ™€ŒŒE ų $ ¼!æ“¾°·¬¶Øµ¤“ ³œ²˜±”°ą'½ø<'œ$,™ą!'½’ĄÆæ<Æ“8Ƴ4Ʋ0Ʊ,ư(ƼŒ¢€ !@Ą˜!™H< ų 6ü@ˆ!@ ¼‚€œ…€$™ŒD$„@ ų 6ü¼p$’’6ü™€Š@ !(! ų @0!Žb¼@@&p…€$™€($„nD€ !0!8!Ʊ'9¦Š ų Ʋ@€!@O¼…€$™€($„p€ !'9©H ų '¦ £ $’éb¼™€€ !@8!$'9fl ų  0!@€!@:¼‚€œ„€$ŒE™€H$„RŠ‚€œ„€$ŒE™€H$„Rō ų $’ž1¼‚"@™ ! ų &EH ¼Ž™ ų  !¼&’€$Ž@’ļ…€$™$„H  ų  !¼™€\ ų  !¼@8!…€$™€(<4Bü€ !$„nD 0!Æ¢'9¦Š ų Ʊ@€!@¼‚Œ™€HŒE ų  !¼™€< ų  !¼!æ<“8³4²0±,°(ą'½@<'œ!Ģ™ą!'½’ĄÆæ<ƾ8Æ·4ƶ0Ƶ,Æ“(Ƴ$Ʋ ƱưƼ‘€˜€! ų &¼b€ Ž"™€Ų&1@’÷@ !&*!ƒ ƒ$V€C!$P™H ų  !@˜!@¼ !‚€œ…€$™ŒD$„S ų 0!¼O$’’ €p*c !@’ü$c•€˜š! !-$a ų @(¼Ž„€£w&ā’ąb"€C!b!™ ų @ !¼'я™€\€@@ ! ų €!€#*$¼C€ …€$™@ !$„H  ų &’’’ł¼&”– š! !&µޤ€’Ņ™€Ų&÷*āz@’ś•€˜`€!ˆ! ų ¼6* !™\&P@’ų&1™Ø ų $ ¼!æ<¾8·4¶0µ,“(³$² ±°ą'½@<'œ„™ą!'½’ÆæhƱdư`Ƽ™€Š'± €€!(!$< ų  !¼ !™€ 0!$b'9fl ų $<@€!@¼‚TB@¤ ™€'9MX ų ¼€!„€$™$„S@ ų @(!¼‚TB@¤$™€'9MX ų ¼€!„€$™$„SP ų @(!¼‚TB@¤(™€'9MX ų ¼€!„€$™$„S` ų @(!¼‚TB@¤L™€'9MX ų ¼€!„€$™$„Sp ų @(!¼‚TB@¤,™€'9MX ų ¼€!„€$™$„S€ ų @(!¼‚TB@¤0™€'9MX ų ¼€!„€$™$„S ų @(!¼‚TB@¤4™€'9MX ų ¼€!„€$™$„S  ų @(!¼‚TB@¤8™€'9MX ų ¼€!„€$™$„S° ų @(!¼‚TB@¤<™€'9MX ų ¼€!™p@ ! ų '„¼@(!„€$™ ų $„Sď¼‚TB@¤@™€'9MX ų ¼€!„€$™$„SŌ ų @(!¼‚TB@¤D™€'9MX ų ¼€!„€$™$„Sä ų @(!¼‚TB@¤H™€'9MX ų ¼€!„€$™$„Sō ų @(!¼‚TB@¤P™€'9MX ų ¼€!„€$™$„T ų @(!¼‚TB@¤T™€'9MX ų ¼€!„€$™$„T ų @(!¼‚TB@¤X™€'9MX ų ¼€!„€$™$„T  ų @(!¼!æh±d°`ą'½p<'œō™ą!'½žpÆæŒÆ¾ˆÆ·„ƶ€Æµ|Æ“xƳtƲpƱlưhƼŒŠÆ„”…€$™€ø‚€ Ƥ$„T0 !Ą! ˆ! ų ŒW¼ !…€$™€ø$„T8 Č! ų @ !¼ !…€$™€ø$„T@ Č! ų @˜!@€!ŽB¼@g&U™€Š$ (! ų ą !¼ą !…€$™¤ ų $„TL¼™€\ ų ą !¼¤™€„$G$ ų ą0!Æ¢TA¼„€$™$„TX ų @(!¼‚ć.”.$Æ“Pb ưLB¹P„”'9œ ų  0!@¼`‚€$¢L@揂€$Æ $”CH ‚€ §£$V$”‚€,Æ (š$TŠbÆ ,…€$  !$„T|€Č! ų '¦,Æ¢$@Ž¼$BÆ¢$'±$°(™@¤$ (! ų $š!¼ b¢$&ư(€C$B`{Æ¢$’š°($żbc$ü…€$  !$„T€€Č! ų 0!Æ¢$@¼$™€\ ų @ !¼$Q…€$  !$„Tˆ€Č! ų 0!@€!@¼$™€\ ų @ !¼$R¢$@˜+`Q¤($ä(!&# ¢r!$ £ ¢  £$$„`Ƥ(ä!$  b™€P` ! ų $_@!@’ų¼¤(™d„$ä ! ų  0!¼ @¢("!`Æ¢( !$  ‚™€P ų $_@ !@’ł¼¤(™dä !(! ų @0!¼ā! @¢(R!b-$…€$  !$„T”'¦0€Č!Æ 0 ų Æ 4¼  !…€$'¦4$„TœÆ¢$€Č! ų @€!Æ¢$@¼ü£($ ć ! ‚’Äw! D@ !¢0 ‚¢0 ‚¢4 ‚¢4$dw! b毤(b#$ …€$  !$„T¤€Č! ų 0!Æ¢$@Ū¼™€¤('„(ä !$€'9W4 ų Ą8!¼„(™€ģ¤$ ų å(!@¼„€$™„$ ų $„T¬¼¢(Į$Bb>$ƒ€…€$$dü”büƒ$„TÜ  !0!§¢€Č! ų ££@ !¼@Æ¢$ €!C$BÆ¢$££‚$ƒ£¢Æ£$$…€  !$„ż4€Č! ų '¦,Æ¢$@¼¢,£¢—™€¤('„(ä !$€'9W4 ų Ą8!£(“¢ć!¼ b“¢ b“¢ b¢(‚$Bb:$ƒ€…€$”b$„Tä  !'¦,€Č! ų §¢Æ¢$@¼€!¢,“£0BC%£¢$…€$'±,$„Tš  !€Č! ų  0!Æ¢$@¼¢,“£0BC%£¢$…€$  !$„Tü€Č! ų  0!Æ¢$@¼¢,“£0BC%£¢$…€$ 0!$„U;  !bZ$#ƒ€‡€$”b  !$åU'¦,€Č! ų §¢Æ¢$@¼€!¢,“£0BC%£¢$‚€$'±,  !$EU€Č! ų  0!Æ¢$@¼¢,“£0BC%£¢$‚€$  !$EU(€Č! ų  0!Æ¢$@¼¢,“£0BC%£¢$‚€$ 0!  !$EU4€Č! ų Æ¢$@¼¢,“£0BĄC%£¢’™€¤('„(ä !$€'9W4 ų Ą8!¢(“£ā!¼ C“£ C¢(ģ$Bb¦'°>‚€$  !$E,¼€Č! ų '¦,Æ¢$@¼ˆ!!¢,$Ą0Rų‚€$'°,  !$E,“€Č! ų 0!Æ¢$@¼¢,$0BB%‚€$  !$E,Ø€Č! ų 0!Æ¢$@¼¢,$Ą0BųB%‚€$  !$E,œ€Č! ų 0!Æ¢$@¼¢,$@0BB%‚€$  !$E,€Č! ų 0!Æ¢$@¼¢,$0BB%‚€$0!  !€Č! ų $E- Æ¢$@¼€!¢,$Ą0Pų‚€$'³,  !$E-€Č! ų `0!Æ¢$@¼¢,$0B€%‚€$  !$E- €Č! ų `0!Æ¢$@¼¢,$Ą0Bų€%‚€$  !$E-€Č! ų `0!Æ¢$@¼¢,$@0B€%‚€$`0!  !€Č! ų $E,ōÆ¢$@¼¢,0B€% Z™€¤($€Ą8!'„('9W4 ų ä !¢(¼ā!2:$H r f p gFÆØ(™¤ŽÅ¢( ! ų āˆ!¼ !™€č'° ų (!¼@!˜!$'¾,.ưX@ Æ ,™€ !Ą8!(!'9W4 ų $€&1‚P&E  !€Č! ų Ą0!$&’Š¼Æ¢$b˜ ¢,**„X™€č¢" ! &1¢,¢"Ą&1—¢,¢"“¢,¢"&1 ų ¼@!!@’Ņ`7#Æ¢(&Ö’Ć$’bżd$ž„€$™„( ų $„U<¼<€’€$4Q€! ų e$¼a&$c’’$’ųb%$c$b¢(™Ø ų $ ¼¢(š!*™@’ź&DUT™Ø ų $ §(ą¼„€$™\ ų $„U`¼ $’’£L`d¢T…€$™€(¤$„Ut'9„  ų ą0!¼YÆ¢T‚TB@™€'9MX ų !¼®ā‚TB@$ø™€'9MX ų $ø¼¤”®āŒ… ;™€¤ą0!'9fl ų $ Æ¢T@:¼&ö–Ā@$SrC$Ū–Ā€C$?$Ū@V!BÆ¢H$B’ž,B@£H!$’ž'¹ '¢8(cš!Æ DÆ @ƹ\Æ¢`d™€P€ ! ų $=@!@¼ @$R™€\ ų € !@ˆ!@¼(B@§H‡€$™€(!–$äU|™€ '$4™€(€(!'9 ų &&@˜!ŒB@¼$!‚€ ™€(§H$D"€(!'9 ų &&’’ŒC@˜!‘!¼`€B’’$F’ŠĄ(Ā@ £d‚€$™¦H€(!$DU” ų ®¼`$`$p$@$WF –b ¤P€Kbˆ!Žc0b @0b@Ć!”d£¢8£¤9”d£¢:£¤;”c£¢<££=@ ˆ@–b6!@V!”B”c bš%–p™ ų  !6!”c$B’’€$¼Æ¢DPšŽc0b @ 0b™€Č ų ¤`¼€(!‡€$™@0!’»$äUĄ@0b‚€$™€(! $D.ō@‡€$ƒ€$™€(!$dUȏ™€(!$äUŠ’ØĄ0!@‚€$™€(!$DUŲ¤@Žb‘*# 0B @$Ƥ@™€ģ„` ų @ !@ ¼‡€$™@(!$äT¬ ų >¼“¢8“£9 @C%Ä !¤‚“¢:“£;C%¤‚“¢<“£=¹@C%'9ƹ@)¤‚™@„\@ ! ų 0!„ ¼²@€!‚€$™€0! ų $DV¼Žb0B@ ˆ@¤@Ń!$„š!Ƥ@¤b ¤p–cŃ0!§D”Å'š E$d$b%¤Ćš!Ž“€’&µ¹P +¢T‚T®ą£@B$p@ @™€'9MX ų ¼€!¤”™€®āŒ… 8@¤ą0!'9_Ü ų $篢TA¼„€$™$„V( ų @(!¼$’’ƧT ūū¼¤¢TæŒ¾ˆ·„¶€µ|“x³t²p±l°hą'½<'œ@™ą!'½’ŲÆæ Æ±ưƼ€˜€ˆ!&Ž™€ø (!@@ !€! ų @’õ¼!æ ±°ą'½(<'œĢ™ą!'½’௿ưƼ‚€Ģ…€$ŒF‚€œ€€!™ŒD ų $„ų¼ !™`æ° '½ <'œp™ą!'½’°ÆæHƵDÆ“@Ƴ<Ʋ8Ʊ4ư0Ƽ™<€˜! Ø!Ą !$$0!ą! ų “°c@ˆ!A¼„€™€$'9Ą” ų $„¼™˜'¢£°$Æ“Ʋ `0!®b !Ƶ ų 4‰š@€!A¼$’žU€ ™€@ ų  !!¼æHµD“@³<²8±4°0ą'½P<'œ|™ą!'½’ŲÆæ Æ¼™€$$'9Ąš ų Æ¢¼æ ą'½(<'œ@™ą!'½’ŲÆæ Æ¼™€$'9Ąš ų Æ ¼æ ą'½(<'œ™ą!'½łXÆæ¤Æ¾ Æ·œÆ¶˜Æµ”Æ“Æ³ŒÆ²ˆÆ±„ư€Æ¼Æ Œ£‚€Ģ™€Š'°@Æ„¬¬CÆ   !(! ų $ ¢¬¼$B'³¬'²'± aÆ¢¬ ų ¼@!™€ų !@ $¢ @]¢@T@(! ų P¼$’’bTƒ¢@@¦ƒ€™€Ō$bĢ”E ŒDŒčB§„<…€Ƥ4Æ£0Æ¢8£ @$„č ų '¤0@˜!@“¼™l'±€ !$č@0! ų  €!@†¼™l !$čČ! ų `0!@l¼}™€Ą‚|£pŒE€b` !@E!”B0B @’ł$cƒ€$™€”Ƥ,¤t ų $e2T@€!@a¼™€ųą !@(!$ ų  ˆ!¼$™<$ ų 0!@!A¼‚€ĄČ! ų $D¼™€ŠĄ !(! ų $ď¼$™€ų(!$  ! Č!Æ¢¼ ų ƶp¼@ !™˜4‰F ų  0!@€!A¼™€t ų ŒC$b¼‚€ĄČ! ų $D¼£ ™€ų„x€ ! Č! ų $¼™€@ ų @ !¼‚€™€ü€ !$E ų $@¼™ ų ą !@¼ £ @‚€$'£,'¹ĄÆ±p$^Ą”Æ£t'·@'¶¼'µ`'“ƹx™l¤p$č ų `0!@’†¼™€Ą ų ` !¼ƒ¢@@™'±@ ų  !@ ¼‚€œ…€ŒD‚€Ģ™ŒF ų $„¼Ī$’’¢¬…€ŒP™€ø$„@ ų  !@|¼'¢Ʊl!'“€'³€Æ¢h'¾$'·,'¶('µ„„€™ ų $„P¼€ !ƒ ™lŒf ų $@®¼ƒ£€$ b«@!`’ļ„€`€!ˆ!®&1$" &…€™€č !‘  ų $„T@’ō¼¹h€Y!¬@h°€‚€™€ø !$Eż¬ ų  ˆ!@‹¼ƒ€™€ø ! Č! ų $eX@ƒ¼Ƴ$Æ ( Æ ,‚€™€ø ! Č! ų $E@¼Ƶ$¢$ŒB@™€Ø$Ą !ą(! ų Ą0!@€!@ ¼¢,@‚€œƒ€™€HŒE ų $d`¼¢$ŒD€$’’™€$’ž!'9Ą  ų ¼¦$ƒˆ¤lb ŒY ų @(!¼’@!™€$ !'9Ą ˆ ų B€ Ž¦¬ ! ų (!¼ @!¢¬™€ØŒB` !@(!@žš 0!€!!¢ @¢¬ŒD€™€$'9Ą  ų @(!@¼‚Œ™DŒD‚€Ģ„€ŒE¢¬™ŒF ų $„˜¼$’’‚Œ™€“ŒD(!B $’ž‚€œ™DŒD(! ų ¼B@!™8 ų '¤@¼@!æ¤¾ ·œ¶˜µ”“³Œ²ˆ±„°€ą'½Ø<'œžą™ą!'½üĄÆæ<ƾ8Æ·4ƶ0Ƶ,Æ“(Ƴ$Ʋ ƱưƼ™€Š‘€€˜!(!'¤˜$€ ų  €!¼’"0™€Š'¤(!$?Č! ų £¢¼’"0™€Š$?(!'¤YČ! ų £¢X¼` !™€\ ų  !@0!,B’@¼‚€œ…€ŒD¦˜™­$„܏™d'±`(! ų  !¼™€\@Č! ų ` !¼'°!™\ @ ų ` !¼°!ø!'“|'µX‚#$ b’ż&1&1’’‚€™€ü !$Eų ų $@¼€!&1$‚#$>bš!&1$‚€™€ü !$Eü ų $@¼&1$‚#$ b’ż&1&1’’ !˜!$„$€ƒ$'b’ū$"b’ś$„$„’ż™€P ų $ @!@¼ @`™¤ (! ų € !¼™€\ ų € !¼@@! ! (!€c$'b$"bā$„ Ā$„$„”8!ˆ*ą!@’ń%0! ĄĄ™¤ ƒ¢€V!&÷¬Q€Ą ! ų  (!¼ƒ¢@™¤  ! Ą(!‚"@‚€™¤ (!  !™¤  !$E ų ¼@&Q‚"@’ƒ…€°˜™€ø$„ ! ų  ˆ!@¼…€™€ø$„ Č! ų  !@ ¼‚€œ…€ŒD™$„0! ų e¼ƒ¢@$’’Œ™4 ų Ž¼™€h ų Ž¼™€° ų @ !¼Ž…€™€x$„ŗ4'¤ ų @!¼ƒ¢X@$’’€œ™4 ų Ž¼™€h ų Ž¼™€° ų @ !¼Ž…€™€x$„ŗ4'¤X ų @ˆ!¼™(ą !'„˜ ų $’’S¼Œ™4 ų Ž¼™€h ų Ž¼@(!™X ų @ !¼™€@ ų @ !¼™€Ä ų Ž¼3€œ™4 ų Ž¼™€h ų Ž¼ !™X ų @(!¼™€@ ų  !¼™€Ä ų Ž¼æ<¾8·4¶0µ,“(³$² ±°ą'½@<'œłp™ą!‡h€ƒ0b’G!B0B @’ś$„$„’’$+b$-$„b`!$„$ Ą$€ƒ$0b$ €ƒ$xb$†$XbĄ !$$„$Āh€ƒ$0b H!€ƒ$xb$Xb$„hH! X!$„HH!++@ X!€$ ’’€‡0ā’M!B$č’Š0CD0J` 0B@+@$č’©$č’É+@’ēq& # LH ¬¤ą !<'œų™ą!™€ˆ(! $ <'œ÷䙹!'½’ŲÆæ Æ±ưƼƤ( ˆ!€!¤(™€ˆ'„( ų $£(0 !¼ ‚€b$cÆ£(@&$’ń¤(:æ ±°,Bą'½(<'œ÷X™ą!‚€0Ę’$C ą‚$„Ā&C!F$„’’$’’¢’ųĄ!ą<'œ÷™ą!‚€0Ę’’ $G ą‚$„Ā&0B’@G!”Bb0&$„’’$’’¢’õąĄ!<'œö¼™ą!$’ü$ƒb$d#¢(#‚€'½’š€8!$Hą '«ā$ēĀ&0B’€H!ŒB‚0&ć+@’ö"$’ü¢$āP!‚€#$IąŒā$ē­b“¢“¤ Ā&0B’€I!ŒC“¢ &d &0„’ €‰ !Œ„d&b&0B’€I!ŒD“¢ d&b&0B’€I!ŒBb0&ź+@’ÜB0¢ā(!‚€ $Dąā$ēĀ&0B’€D!ŒBb0&å+@’öĄ!ą'½Œ£(b@€8!„$†f*@ f#(b@¬£$āD !‚$Bb*@ !ą€! (¢‚Fƒ$b¢*@£#ć !$E’ž(¢@’ō$‡ !ą€!(¢‡ƒĒ+@ £@#ę$b¢*@# !%’ž(¢@’ņ$‰ !ą€!<'œōp™ą!0„’$ƒ’g(b(@`H!ą4’’$„’?$0!§@!&!$Ę(†!8Ą@’ś(@‚€@$Bb!”bBC!Hōą0B’’<'œóģ™ą!0…’’,¢@$ ™ą!d(!%)’Ų,¢] Ą@’ū@‚€8!$F”Ä”Ć$čd#ĀC!CD!¢+@$Ę1’$'ā’ņé!ą0B’8! 0!†!Bb$$ē@’ż$C’’$ĘÅ’÷ąą!<'œó ™ą!'½’ŲÆæ$Ʋ ƱưƼ™€\€!Ą€! ų  ˆ!B!¼p !d@!‚"&1 b@’ś$c@!æ$² ±°ą'½(<'œņ¤™ą!'½’ŲÆæ Æ±ưƼ™€\€ˆ! ų  €!¼"!‚& b@’ü$c !æ ±°ą'½(<'œņ@™ą!'½’ČÆæ0Ƶ,Æ“(Ƴ$Ʋ ƱưƼ™€\Ą ! Ø!ą˜! ų €!$Q¦H‘€!Š+@¼ €!™€ų@(! ų ` !¼q !™d (! ų €0!¼!æ0µ,“(³$² ±°ą'½8<'œń„™ą!'½’ĄÆæ8Æ·4ƶ0Ƶ,Æ“(Ƴ$Ʋ ƱưƼ³P°T€ø! °!ĄØ!ą! !ŽQ ąČ! ų ŽF¼` !™€(! 0! ų @8!&R ¼@P+`&’’‚ !b˜!€#.Ą !@’ē (!€!æ8·4¶0µ,“(³$² ±°ą'½@<'œš”™ą!'½’ŲÆæ$ư Ƽ,‚@  €!†€$0‡š™€0‚$Ę89 Æ¢0‚š†€8B0„’$A$P™€b8 Ƥ$Ęp ! ų $!¼æ$° ą'½(<'œš™ą!'½’௿ưƼ4 ‚+ €!@Ą(!‚€$$FP‚€$Fx™€€8! ų  !!¼æ°ą'½ <'œļ”™ą!'½’ŠÆæ,ư(Ƽ †‡‚ƒƦ†€™€ €!Ƣƣ  !$Ę| ų $!¼ æ,°(ą'½0<'œļ(™ą!'½’ČÆæ4ư0Ƽ(†ˆ‡‚ƒ„Ʀ†€™€ €!ƤÆ¢Æ£ÆØ   !$Ęą ų $!¼(æ4°0ą'½8<'œī¬™ą!'½’ŠÆæ,Æ“(Ƴ$Ʋ ƱưƼ™€\”€$ ų €ˆ!¼@!‚0 ų ¢ ¼¢0`ˆ!.B™ (!&3&„L,@’ō&Rž™\ !æ,“(³$² ±° '½0<'œī™ą!'½’ČÆæ0Ƶ,Æ“(Ƴ$Ʋ ƱưƼ€ˆ!€! Ø!   !™€\  ! ų  €!¼ !™€\Č! ų @ !$B¼!T˜# ų @¼ ˆ!2€!S*™€ä  !(!€0!@’ó&Rˆ! !æ0µ,“(³$² ±°ą'½80„’’0ƒš$b$ b0ƒ $ b$b 0‚8B0„$‚ą!8‚ą+ą$0„’’0ƒ$b0‚’ą$b0„’,‚Ž@$‚ą0B’,‚@ą!$‚’žą0B’  €!$‚ö ,Be@$‚ģx$Ī,Bé$'( $ “b$Ī¢$ Bd+@$‚čC+@d #<ff4Bfg‚ĆCC#€C!‚$Ī¢$b’’,B @$’’ą`!$Ī¢€$‚ą$ “€D!Bąb!<'œėd™ą!'½’ŲÆæ$ư Ƽ™@'„$  ų €€!¦¼Š:@(!,Bį@7ƒ€D€ĀŒg@G!€D$ ,¢$ P!€$"P $‚’Ÿ0B’,B@ $n€Ā8ƒa@G!€D P!€P $n‚ !$$l‚$u,¢Ż@$¢$  $‚!,¢@ $¢’ž$ $ !$$B%D%C%0B’’!æ$° ą'½(<'œź,™ą!'½’ŠÆæ,ư(Ƽ 0ƒ’’0fš$  €!Ā0g’,ā@ ‚€$ $BÜ$Ā ‚€$,ā@‚€$‚€$$B@0!‚€$$FČ0e $ ¢ ‚€$0c$DČ$b‚€‚€$ē $C÷D$ē’ž $CÆø$DČ$¢‚€$€!$D~Œ€!Ʀ†€™€Æ¤Æ£ !$Ę ų $!¼ æ,°(ą'½0™€ąx! ų $™€ąx! ų $€™€ąx! ų $}™€ąx! ų ${™€ąx! ų $x™€ąx! ų $w™€ąx! ų $u™€ąx! ų $r™€ąx! ų $p™€ąx! ų $o™€ąx! ų $n™€ąx! ų $m™€ąx! ų $k™€ąx! ų $j™€ąx! ų $i™€ąx! ų $g™€ąx! ų $f™€ąx! ų $d™€ąx! ų $b™€ąx! ų $`™€ąx! ų $^™€ąx! ų $]™€ąx! ų $\™€ąx! ų $X™€ąx! ų $W™€ąx! ų $V™€ąx! ų $U™€ąx! ų $T™€ąx! ų $Q™€ąx! ų $P™€ąx! ų $N™€ąx! ų $L™€ąx! ų $K™€ąx! ų $H™€ąx! ų $G™€ąx! ų $E™€ąx! ų $C™€ąx! ų $@™€ąx! ų $?™€ąx! ų $<™€ąx! ų $:™€ąx! ų $6™€ąx! ų $5™€ąx! ų $4™€ąx! ų $3™€ąx! ų $1™€ąx! ų $0™€ąx! ų $.™€ąx! ų $,™€ąx! ų $+™€ąx! ų $)™€ąx! ų $'™€ąx! ų $& Incorrect version of TSPEC struct: expected %d; got %d TSPEC arg length too short: expected %d; got %d REJECTEDUNKNOWNPENDINGACCEPTEDlength %d TID %d %s tsinfo 0x%02x 0x%02x 0x%02x AC[%d] : Trigger enabled AC[%d] : Delivery enabled AC[%d] : Trig & Delv enabled AC [%d] : Legacy Power save fixed sizenom_msdu_size %d %s max_msdu_size %d min_srv_interval %d max_srv_interval %d inactivity_interval %d suspension_interval %d srv_start_time %d min_data_rate %d mean_data_rate %d peak_data_rate %d max_burst_size %d delay_bound %d min_phy_rate %d surplus_bw %d medium_time %d %2d.%-2d %u bsscfg:malloc(%d) failed, free %d batched commands and exit batching mode batching %dth command %d calling add_one_batched_cmd() at non-command-batching mode, weirdNo args providedEnable/disable value not providedIOCTL GET command %d is not supported in batching mode Usage: ledbh [led#] [behavior#]only 4 led supportedwl_ledbh: fail to get. code %x wl_ledbh: fail to setwl_ledbh: fail to getled %d behavior %d get external assert logs: %d Version mismatch: version = 0x%x, expected 0x%x id: time(ms) string%d: %d %sassoclist_infoAssociated stations:%d Num Mac Address Time%d %s %s Packets matched for filter '%d': %d Total packets discarded : %d Total packet forwarded : %d Num filters: %d Id :%d Negate :%d Type :%d Offset :%d Pattern len :%d Mask :0x%02x Pattern :0xLost frame count %d RSSI %d Signal to noise ratio %d tx_summed = %d tx_iph_fill = %d tx_tcp_fill = %d tx_udp_fill = %d tx_icmp_fill = %d rx_iph_good = %d rx_iph_bad = %d rx_tcp_good = %d rx_tcp_bad = %d rx_udp_good = %d rx_udp_bad = %d rx_icmp_good = %d rx_icmp_bad = %d tx_tcp_errinj = %d tx_udp_errinj = %d tx_icmp_errinj = %d rx_tcp_errinj = %d rx_udp_errinj = %d rx_icmp_errinj = %d Cannot set toe stats, use 'wl toe_stats_clear' to clear the countershost_ip_entries = %d host_ip_overflow = %d arp_table_entries = %d arp_table_overflow = %d host_request = %d host_reply = %d host_service = %d peer_request = %d peer_request_drop = %d peer_reply = %d peer_reply_drop = %d peer_service = %d Cannot set arp stats, use 'wl arp_stats_clear' to clear the countersMAC address must be specifiedMalformed MAC address parametertsinfo 0x%02X 0x%02X 0x%02X TID %d User Prio %d Direction %d nvget: missing argumentsnvget error: extra arg "%s" nvram_getnvdump error: extra arg "%s" nvram_dumpWrong syntax => dev offset [val]Unknown dfs state %d. state %s time elapsed %dms radar channel cleared by dfs channel spec %d channel %d Unable to get remote endpoint's hwaddrUnable to get local endpoint's WPA rolesupplicantauthenticatorLocal endpoing's WPA role: %s List of DPT connections:%s: status 0x%x rx %d tx %d rssi %d Receive: good packet %d, bad packet %d, othercast good packet %d Transmit: good packet %d, bad packet %d %d mW (%d.%d dBm) CCK %d OFDM %d -i-w-cInvalid channel %d Too many channels (max 14)With option '-c' specified, a channel list is requiredtxfifo_szfifo %d size %d Usage: %s antenna_index[0-3] nphy_rssiant nphy_rssiant ant%d = %d Usage: %s testindex[1-4] diag diag test %d failed(error code %d) diag test %d passed error: missing argumentserror: missing addresserror: could not parse MAC address %s ampdu_send_delbaampdu_send_addbaampdu_rr_retry_limit_tidAMPDU regular rate retry limit for tid %d: %d ampdu_retry_limit_tidAMPDU retry limit for tid %d: %d ampdu_tidAMPDU for tid %d: %d Key %d is primary No primary key setScan in progress.current scan channel %d No scan in progress.current mac channel %d target channel %d seq_stopcalling seq_stop when it's already out of batching modeno command batchedseq_startfailed to send seq_startseq_listfailed to send seq_listfailed to send seq_stopcalling seq_start() when it's already in batching modePAPD EPS TABLE:%d-j%d %d+j%d OnOffSet assert_bypass error %d Set frameburst error %d Set rifs error %d wseccur_mcssetMCS SET : [ %d gpiooutgpiocontrol 0x%x gpioout 0x%x gpioouten 0x%x get: missing argumentsget: error, extra arg "%s" SROMOTPUnrecognized source %d %s:%sscblist info %s HCI_cmd\x%02X%u.%u.%u.%u%02X%s %s ERROR: no valid ether addr providedError setting variable %s Error getting variable %s Error on_period cannot be 0Error off_period cannot be 00x%x(%d) %d %d %d %d %d %d lpphy_txloccwme_dpDiscard oldest first: BE=%d BK=%d VI=%d VO=%d %s: Invalid parameter %s: STA only wme_qosinfoMax SP Length = %d, APSD: BE=%d BK=%d VI=%d VO=%d set: error parsing value "%s" as an integer set: missing argumentsset: error parsing value "%s" as an integer for set of "%s" %d (0x%x) Incorrect version of RADAR_ARGS struct: expected %d; got %d version %d npulses %d ncontig %d min_pw %d max_pw %d thresh0 0x%x thresh1 0x%x blank 0x%x fmdemodcfg 0x%x npulses_lp %d min_pw_lp %d max_pw_lp %d min_fm_lp %d max_span_lp %d min_deltat %d max_deltat %d autocorr 0x%x st_level_time 0x%x t2_min %d fra_pulse_err %d npulses_fra %d npulses_stg2 %d npulses_stg3 %d percal_mask 0x%x quant %d min_burst_intv_lp %d max_burst_intv_lp %d nskip_rst_lp %d max_pw_tol %d feature_mask 0x%x All interference mitigation is disabled.Non-wireless LAN Interference mitigation is enabled.Wireless LAN Interference mitigation is enabled.Auto Wireless LAN Interference mitigation is enabled and not activenot active, and noise reduction is enabledLoose interpretation of 11h spec - may join non 11h AP.Strict interpretation of 11h spec - may not join non 11h AP.802.11d modeLoose interpretation of 11h+d spec - may join non-11h APsinvalid value 0x%x Too few arguments wl cac_delts_ea ver 0xaa 0xbb 0xcc xx:xx:xx:xx:xx:xx where ver is the tspec version where 0xaa is byte[0] of tsinfo (bits 0-7) where 0xbb is byte[1] of tsinfo (bits 8-15) where 0xcc is byte[2] of tsinfo (bits 16-23) where xx:xx:xx:xx:xx:xx is mac address ) wl cac_tspec 0xaa 0xbb 0xcc xx:xx:xx:xx:xx:xx This command can only be executed on the STA wl cac_tspec 0xaa 0xbb 0xcc wl cac_delts ver a b c where a is byte[0] of tsinfo (bits 0-7) where b is byte[1] of tsinfo (bits 8-15) where c is byte[2] of tsinfo (bits 16-23) wl cac_addts ver dtoken tid dir psb up a b c d e ... where ver is the structure version where dtoken is the dialog token [range 1-255] where tid is the tspec identifier [range 0-7] where dir is direction [uplink | downlink | bi-directional] where psb is power save mode [legacy|U-APSD] where up is user priority [range 0-7] where a is the nominal MSDU size where b is bool for fixed size msdu [ 0 and 1] where c is the maximum MSDU size where d is the minimum service interval where e is the maximum service interval where f is the inactivity interval where g is the suspension interval where h is the minimum data rate where i is the mean data rate where j is the peak data rate where k is the max burst size where l is the delay bound where m is the surplus bandwidth [fixed point notation] Name must be less than 32 characters dpt_fnameSTA MAC must be specified Malformed STA MAC parameter Version mismatch, please upgrade wl mimo_ss_stf: bad stf mode. -bbwl mimo_ss_stf: wrong -b option, "-b a" or "-b b" clearwowl_wakeindPCI Indication setMAC Indication set MAGIC packet received Packet received with Netpattern Disassociation/Deauth received Retrograde TSF detected Beacons Lost Test Mode Broadcast/Mcast frame received Unicast frame receivedNo wakeup indication setpkteng_stoptxrxpktengpkteng_starttxwithackrxwithackInvalid command name %s %s: AP only wme_maxbw_paramsWME bandwidth limit: %s: bandwidth limit %d Need value following %s bebkvivoUnknown access category: %s cac_addtscac_deltsunknown command G711signaluplinkdownlinkunknown direction option [ uplink (1) | downlink (2) ] UDLUULbi-directionallegacyU-APSDSetting min_phy_rate to 0x%x wme_tx_paramsWME TX params: %s: short %d. sfb %d. long %d. lfb %d. max %d Unknown access class: %s sfblfbmax_ratemaxUnknown parameter: %s Value for %s must be < %d autob/gcreatemodifydeleteerror: invalid mode stringerror: missing eadpt_endpointaddremoveerror: missing mode valuedpt_denyqtxpower%d.%d dBm = %d mw. %s -uTxPower is %d qdbm, %d.%d dbm, %d mW Override is %s -o-d-q-mwowl_statusStatus of last wakeup: flags:0x%x Wake-on-Loss-of-Beacons enabled Wake-on-Magic frame enabled Wake-on-Net pattern enabled Wake-on-Deauth enabled Retrograde TSF enabled Test-mode enabledfixed0x%02x %s invalid %d args UTX 0x%02x Invaild UTX parameter: %s URX 0x%02x Invaild URX parameter: %s DTX 0x%02x Invaild DTX parameter: %s DRX 0x%02x Invaild DRX parameter: %s Usage: %s [channel | All ] per_chan_infoInvalid ChannelNot supported in current localeChannel %d A BandB Band, RADAR Sensitive, Restricted, Passive, Temporarily Out of Service for %d minutes%c a b ? txinstpwrLast B phy CCK est. power: %2d.%d dBm Last B phy OFDM est. power: %2d.%d dBm Last A phy est. power: %2d.%d dBm %s: %2d.%-2d%s: CCKOFDMMCS 20MHzMCS 40MHzCCK OFDM Legacy OFDM 20MHz SISOLegacy OFDM 20MHz CDD MCS 0-7 20MHz SISO MCS 0-7 20MHz CDD MCS 0-7 20MHz STBC MCS 8-15 20MHz SDM Legacy OFDM 40MHz SISOLegacy OFDM 40MHz CDD MCS 0-7 40MHz SISO MCS 0-7 40MHz CDD MCS 0-7 40MHz STBC MCS 8-15 40MHz SDM MCS 32 Could not query wsec status. %3d: %3d - %3d: (default)%3d: %-17s Key %d: WEP1WEP128TKIPAES CCMAES OCB MSDUAES OCB MPDUNo key presentsoft len %d, data 0x (%.*s)[ .5(b)%d%s%s sta_info ERROR: unknown driver station info version %d STA %s: rateset idle %d seconds in network %d seconds AUTHENTICATED ASSOCIATED AUTHORIZED state:%s%s%s BRCM ABCAP WME PS APSD_BE APSD_BK APSD_VI APSD_VO N_CAP flags 0x%x:%s%s%s%s%s%s%s%s%s tx pkts: %d tx failures: %d rx ucast pkts: %d rx mcast/bcast pkts: %d rate of last tx pkt: %d kbps rate of last rx pkt: %d kbps %04d: %02x ssid too longget returned error 0x%x set returned error 0x%x IE header truncated: ID: 0x%02X IE data truncated: ID: 0x%02X Len: %d ID: 0x%02X Len: %d Data:Data: pmkid entries : %d PMKID[%d]: %s = set cmd ignoredAssoc req: len 0x%x capab 0x%x listen 0x%x reassoc bssid %s assoc_req_iesassoc req IEs: 0x%02x Assoc resp: status 0x%x aid 0x%x assoc_resp_iesassoc resp IEs: 0x%02x Byte count %d is odd srom[%03d]: 0x%04x not supported on this chiprssi[%d] %d 0XMask invalid format. Needs to start with 0xMask invalid format. Needs to be of even lengthpkt_filter_addPolarity not providedFilter type not providedOffset not providedBitmask not providedPattern not providedMask and pattern not the same sizePeriod (msec) :%d Length :%d Packet :0xkeep_aliveNetwork packet not provideddelclrwowl_patternStarting offset not providedMask not providedPattern value not provided#of patterns :%d Pattern %d: Offset :%d Masksize :%d Mask :0x PatternSize:%d Pattern :0xwowl_pktDest of the packet needs to be providedbcastff:ff:ff:ff:ff:ffucastEA of ucast dest of the packet needs to be providedtype - magic/net needs to be providedmagicnetpattern not provided%d %d %d %d %d %d %d Too few/many arguments (require %d, got %d) passive dwell not in range %d active dwell not in range %d Width Trigger Scan Interval not in range %d Width Channel Transition Delay Factor not in range %d Passive Total per Channel not in range %d Active Total per Channel not in range %d Activity Threshold not in range %d vndr_ieTotal IEs %d IE index = %d -----------------Pkt Flg = 0x%x Length = %d OUI = %02x:%02x:%02x Error %d getting IOVar Invalid packet flag 0x%x (%d) IE length should be <= %d IE length should be >= %d Invalid OUI Data bytes should be specified for IE of length %dPlease specify all the data bytes for this IE Ignoring data bytes for IE of length %dmemory alloc failure Error parsing OUI arg unexpected param %s lifetimeLifetime for access class '%s' is %dms bcmerrorstr%s: Error getting the last error %s: %s passphrase must be between %d and %d characters long dpt_pmkKey index %d out of range. Should be positive. Key %d TSC: 0x%04x:%08x Invalid byte count %d, must be even Count %d too large cisdumpFailed cisdump request: %d Built-in defaultExternal SPROMInternal OTPUnknown?Source: %d (%s) Maximum length: %d bytes Byte %3d: %s %s %s %s -aerror: expected interface name after option %s -x-h--clientbatch--%s: missing " = " in long param "%s" %s: missing value after " = " in long param "%s" %s: only single char options, error on param "%s" %s: missing value parameter after "%s" wl_rxiqest%s: could not parse "%s" as an int for the sample count %s: sample count too large %d(10 <= x <= 16) %s: could not parse "%s" as an int for antenna (0, 1, 3) %s: invalid antenna select %d %ddBm %ddBm %ddBm rm_reqwl_rm_request%s: could not parse "%s" as an int for the token %s: could not parse "%s" as an int for channel %s: could not parse "%s" as an int for duration basicccarpi%s: could not parse "%s" as a measurement type %s: no measurement requests specified mcs index %d stf mode %d %s legacy rate %d%s Mbps stf mode %d %s wl_nrate5.5%s: could not parse "%s" as a rate value %s: cannot use -r and -m %s: could not parse "%s" as an int for mcs %s: could not parse "%s" as an int for stf mode %s: you need to set a legacy or mcs rate cfgconfigconfiguration%s: could not parse "%s" as an integer for the configuartion index ssidCurrent SSID: "%s" SSID arg "%s" must be 32 chars or less Setting SSID "%s" bssidrmwepwsec_keynvsetnvset: missing argumentsnvset error: extra arg "%s"; format is name=value (no spaces around '=') nvset error: no '=' in "%s", format is name=value (no spaces around '=') Could not parse "%s" as a regulatory revision in the country string "%s" Could not parse a 2-3 char country code in the country string "%s" %d.%d RC%d.%dFailed to allocate dump buffer of %d bytes verbcmerrorError %d on query of driver dump apstaCan't work with AP parameters on STA wme_ac_stawme_ac_apfor STAadvertised for STAfor APAC Parameters %s Warning: AC params out of order%s: raw: ACI 0x%x ECW 0x%x TXOP 0x%x dec: aci %d acm %d aifsn %d ecwmin %d ecwmax %d txop 0x%x eff: CWmin %d CWmax %d TXop %dusec acmonoffacm value must be 1|0 aifsnaifsn %d out of range (%d-%d) ecwmaxecwmax %d out of range (%d-%d) ecwminecwmin %d out of range (%d-%d) txoptxop %d out of range (%d-%d) tpcerror: unknown measurement type %s error: missing target addressunrecognized band value %d unsupported band: %s Problem parsing MAC address "%s". tx %s bb/radio/ctl1 %d/%d/%d manualwpa_auth0x%x Disabled%s is not a valid WPA auth mode Inavlid user argument. Values may be a bitvector or list of names from the set. 0x%04x %smissing country abbrev invalid country abbrev: %s missing band 0x%04x debugunknownparsing "%s", too many rates specified, max is %d rates unable to convert the rate parameter "%s" unable to convert trailing characters "%s" in the rate parameter "%s" -1Warning: Basic rate attribute ignored for "%s" command allBad Args: at least one rate must be marked Basic Need to specify at least one parameter band option "all" is for set only, not get%s is 0x%04x(%d) radioregsyntx0tx1rx0rx1downerror: missing counterror: missing channelError: bad parameters "%s" wl_scan: missing " = " in long param "%s" wl_scan: missing value after " = " in long param "%s" wl_scan: only single char options, error on param "%s" wl_scan: missing value parameter after "%s" scan_typepassivescan_type value should be "active" or "passive", but got "%s" bss_typeinfraibssadhocanybss_type value should be "bss", "ibss", or "any", but got "%s" could not parse "%s" as an ethternet MAC address nprobescould not parse "%s" as an int for value nprobes could not parse "%s" as an int for active dwell time could not parse "%s" as an int for passive dwell time homecould not parse "%s" as an int for home channel dwell time channelscould not parse channel number starting at substring "%s" in list: %s ,too many channels (more than %d) in channel list: %s error parsing channel list arg iscan_siscan_cunknown iscan command: %s --duration=Error allocating %d bytes for scan params iscanwl_parse_assoc_params: missing " = " in long param "%s" wl_parse_assoc_params: missing value after " = " in long param "%s" wl_parse_assoc_params: only single char options, error on param "%s" wl_parse_assoc_params: missing value parameter after "%s" could not parse as an ethternet MAC address string "%s" before ',' or ' ' is too long could not parse chanspec starting at "%s" in list: %s too many chanspecs (more than %d) in chanspec list: %s error parsing chanspec list arg no arguments to wl_reassoc could not parse %s as an Ethernet MAC address could not parse reassociation parameters mbss16mbss4Bad value: %s Missing ag0Missing ag1wl_antgain: fail to setwl_antgain: fail to get antgainag0=%x ag1=%x Missing maxp2ga0Missing maxp2ga1Missing maxp5ga0Missing maxp5ga1Missing maxp5gla0Missing maxp5gla1Missing maxp5gha0Missing maxp5gha1maxpowerwl_phy_maxpower: fail to setwl_phy_maxpower: fail to get maxpowermaxp2ga0=0x%x maxp2ga1=0x%x maxp5ga0=0x%x maxp5ga1=0x%x maxp5gla0=0x%x maxp5gla1=0x%x maxp5gha0=0x%x maxp5gha1=0x%x tssipos2gextpagain2gpdetrange2gtriso2gantswctl2gwl_phy_fem: fail to set fem2gfem2g settssipos5gextpagain5gpdetrange5gtriso5gantswctl5gwl_phy_fem: fail to set fem5gfem5g setwl_phy_fem: fail to get fem2gtssipos2g=0x%x extpagain2g=0x%x pdetrange2g=0x%xtriso2g=0x%x antswctl2g=0x%x wl_phy_fem: fail to get fem5gtssipos5g=0x%x extpagain5g=0x%x pdetrange5g=0x%xtriso5g=0x%x antswctl5g=0x%x cck2gpoofdm2gpoofdm5glpoofdm5gpoofdm5ghpowl_phy_povars: fail to setphy %x band %x err %d cck2gpo=0x%x ofdm2gpo=0x%x ofdm5glpo=0x%x ofdm5gpo=0x%x ofdm5ghpo=0x%x %s=0x%x wl_phy_pavars: fail to setphy %x band %x chain %d err %d sample_collect.dat-fsample_collectwbError writing %d bytes to file, rc %d! Wrote %d bytes Problem opening file %s Ignoring arguments for %s eirpchanspecCurrent channel: %s User Target: %2d.%-2d dBm Regulatory Local Max: %2d.%-2d dBm Regulatory Local Constraint: %2d.%-2d dB Yes, channel is EIRPNo, channel is ConductedAntgain used in Channel Max: %s Hardware Power Control: HW PWRCTL OnHW PWRCTL OffRegulatory Channel Max: %2d.%-2d dBm SROM antgain: 2G: %d.%d dB, 5G: %d.%d dB Min of Reg & Local Limits: CCK: %d.%d OFDM: Last B phy CCK est. power: %2d.%-2d dBm Last B phy OFDM est. power: %2d.%-2d dBm Srom limit B/G:Last B phy target power:Last A phy est. power: %2d.%-2d dBm Srom limit A:OFDM: Last A phy target power:HWSWPower Control: %s, %s Current channel: %s BSS channel: %s BSS Local Max: %2d.%-2d dBm BSS Local Constraint: %2d.%-2d dB User Target: %2d.%-2d dBm SROM antgain: 2G: %d.%d dB, 5G: %d.%d dB Regulatory Limits:Board Limits:Power Target:Last est. power: %d.%d Last est. power: %d.%d dBm Last CCK est. power: %d.%d dBm Maximum Power Target among all rates: Rate index with Maximum Power Target: %d Last adjusted est. power : wl_dump_chanspecs%s: could not parse "%s" as an int for band %s: invalid band %d %s: could not parse "%s" as an int for bandwidth %s: invalid bandwidth %d %s: please provide country abbrev %s: you need to set a band, '-b <5|2>' %s: you need to set a bandwidth, '-w <20|40>' %s (0x%04x) %s (0x%x) wl_chanspec%s: could not parse "%s" as an int for the channel %s: invalid channel %d %s: could not parse "%s" as an int for ctl sideband %s: invalid ctl sideband %d %s: you need to set a channel, '-c ' %s: you need to set a ctl sideband, '-s <-1|0|1>' Chanspec set to 0x%x /var/wlanChipIdwlanChipId=%s 43222This command can only be executed on the APinvalid chanspec (0x%x) apcschspecchanspec 0x%4x selected channel %d selected rm_repMeasurement Report: token %d, length %d BasicCCARPI Report : %s Parallel | LateIncapableRefusedflags : 0x%02x (%s) flags : 0x%02x token : %4d (a)channel : %4d %s start tsf: 0x%x:%08x duration : %4d TU Error: partial report element, %d report bytes remain, element claims %d Basic bits: 0x%08x Carrier Fraction: %d / 255 Power <= %3d: %3d < Power <= %3d: %3d < Power : %3d Report : %d wds_wpa_roleUnable to set local endpoint's WPA roleInvalid WPA role %s. %u:authenticator, %u:supplicant, %u:auto Local endpoint's WPA role: %s %d Kbps%d%s Mbpsa_%sbg_%s Incorrect version of counters struct: expected %d; got %d %s: tx frames: %d bytes: %d failed frames: %d failed bytes: %d rx frames: %d bytes: %d failed frames: %d failed bytes: %d foward frames: %d bytes: %d tx frames time expired: %d Incorrect version of delta stats struct: expected %d; got %d %s %d txframetxbytetxretranstxfailrxframerxbyterx1mbpsrx2mbpsrx5mbps5rx6mbpsrx9mbpsrx11mbpsrx12mbpsrx18mbpsrx24mbpsrx36mbpsrx48mbpsrx54mbps Displayed values may be incorrecttxerrorrxerrortxprshorttxdmawartxnobuftxnoassoctxchittxcmissresettxserrtxphyerrtxphycrstbttd11_txfrag %d d11_txmulti %d d11_txretry %d d11_txretrie %d d11_txrts %d d11_txnocts %d d11_txnoack %d d11_txfrmsnt %d rxcrcrxnobufrxnondatarxbaddsrxbadcmrxduprxfragerrrxruntrxgiantrxnoscbrxbadprotorxbadsrcmacd11_rxfrag %d d11_rxmulti %d d11_rxundec %d rxctlrxbaddarxfilterrxuflo: txallfrmtxrtsfrmtxctsfrmtxackfrmtxdnlfrmtxbcnfrmtxtplunfltxfunfl: tkipmicfailltkipicverrtkipcntrmsrtkipreplayccmpfmterrccmpreplayccmpundecfourwayfailwepundecwepicverrdecsuccessrxundecrxfrmtoolongrxfrmtooshrtrxinvmachdrrxbadfcsrxbadplcprxcrsglitchrxstrtrxdfrmucastmbssrxmfrmucastmbssrxcfrmucastrxrtsucastrxctsucastrxackucastrxdfrmocastrxmfrmocastrxcfrmocastrxrtsocastrxctsocastrxdfrmmcastrxmfrmmcastrxcfrmmcastrxbeaconmbssrxdfrmucastobssrxbeaconobssrxrsptmoutbcntxcanclrxf0ovflrxf1ovflrxf2ovfltxsfovflpmqovflrxcgprqfrmrxcgprsqovfltxcgprsfailtxcgprssucprs_timeoutrxnackfrmsconstxnacktxglitch_nacktxbursttxphyerrortxchanrejpktengrxducastpktengrxdmcastciswriterb%s: No such file or directory error %d reading %s File %s is too large len %d sizeof(cish) %d total %d ciswrite failed: %d File %s too large File %s looks like an nvserial file, use nvotpw nvserialFile %s is not an nvserial file File %s has an odd length (%d) rawWriting %d bytes from %s file %s to otp ... Error %d writing %s to otp Programming %s... error reading %s Committing image to flash... Done Successfully downloaded %d bytes *** UPGRADE FAILED! *** (status %ld) srclearsrcrcsrclear takes only one arg File %s is %d bytes but lacks a REV4/ signature File %s is %d bytes, not %d or %d or %d bytes srcrc only takes one arg %s is not an integer Byte offset (%d) is odd or negative Data extends past %d bytes Writing srom. ioctl %d, iolen %d, sroff %d, len %d Total %d host addresses WPAWPA2%s/NONE%s/WEP40%s/TKIP%s/AES%s/WEP104%s/0x%x0x%02x%02x%02x/0x%02xjoin_prefPref RSSI <%d extra bytes in pref data> Pref BAND: len = %d 0x%x AUTO (no preference) 0x%x 5 GHz 0x%x 2.4 GHz 0x%x Use ASSOC_PREFER value Pref WPA: len = %d %d ACP Specs %s-NONEU:M:Any <%d extra bytes> RSSI Delta for Pref BAND: len = %d RSSI boost %ddb Pref 0x%x: len = %d XXRSN:WPA: multicast cipher: WEP64AES-OCBAES-CCMPRSNUnknown-%s(#%d) Unknown-%02X:%02X:%02X(#%d) unicast ciphers(%d): NONE WEP64 WEP128 TKIP AES-OCB AES-CCMP WPA-Unknown-%s(#%d) AKM Suites(%d): None WPA WPA-PSK Unknown-%s(#%d) Unknown-%02X:%02X:%02X(#%d) Capabilities(0x%04x): No %sPre-Auth, %sPairwise, %d PTK Replay Ctr%s%d GTK Replay Ctr%s No %s Capabilities advertised ManagedAd HocMode: %s RSSI: %d dBm noise: %d dBm Flags: FromBcn Cached Channel: %d BSSID: %s Capability: ESS IBSS Pollable PollReq WEP ShortPre PBCC Agility ShortSlot CCK-OFDM Supported Rates: 802.11N Capable:2.4 Chanspec: %sGHz channel %d %dMHz (0x%x) Control channel: %d 802.11N Capabilities: 40Mhz SGI20 SGI40 Supported MCS : [ Sorry, your driver has bss_info_version %d but this program supports only version %d. Not associated. Last associated with iscanresultswl_get_iscan buflen 0iscanresults incompleteiscanresults completeiscanresults pendingiscanresults abortediscanresults returned unknown status %d toe_olarp_ol0x%x msg values may be a list of numbers or names from the following set. Use a + or - prefix to make an incremental change. 0x%04x %s, %sinsufficient arguments wsec test_type may be a number or name from the following set:Usage: %s [-a|i ] [-h] [-d|u|x] [arguments] -h this message and command descriptions -h [cmd] command description for cmd -a, -i adapter name or number -d output format signed integer -u output format unsigned integer -x output format hexdecimal Too many arguments (%d) for command %s %s (%s/%d) %s No country set%s () %s Supported countries: country code and long name%s %s Argument "%s" could not be parsed as a country name, country code, or country code and regulatory revision. Argument 1 "%s" could not be parsed as a country code, or country code and regulatory revision. Argument "%s" had a revision. Arg 2 must be a country name or country code without a revision Argument 2 "%s" could not be parsed as a country name or country code Driver does not support full country spec interface, only a country name or code may be sepcified ccmocbnotxError allocating %d bytes for assoc params wepkeywepInvalid key index %d specified imode%s %s: expected argument after "infra" keyword but command line ended. ad-hocmanaged%s %s: unrecongnized parameter "%s" after "infra" keyword amodeopensharedwpanonewpawpapskwpa2wpa2psk%s %s: unable to parse parameter "%s" addwepNo key specified 54g LRS54g Legacy B54g Auto54g Only54g Performance%s (%d) gonlyperflrsmsglevelBits >32 are not supported on this driver version 0x%x%08xMsg bits >32 take only numerical input in hex Invalid entry for msglevel 0x%x00000000 %sdump: error on query of WLC_DUMP dump: error on query of dump list Failed to allocate buffer of %d bytes vendorid 0x%x deviceid 0x%x radiorev 0x%x chipnum 0x%x chiprev 0x%x corerev 0x%x boardid 0x%x boardvendor 0x%x boardrev %s driverrev 0x%x ucoderev 0x%x bus 0x%x phytype 0x%x phyrev 0x%x anarev 0x%x rdvarwrvarcisconvertcis_sourceError %x: cannot get cis_source RAWmanfproductnamemanfidprodidmacaddrArgument does not look like a MAC address: %s ccoderssismf2grssismc2grssisav2gbxa2grssismf5grssismc5grssisav5gbxa5gbuffer size %d bytes: 0x%.02x Nothing to write!cisvarBad variable name: %s Variable %s does not exist in sromrev %d %s=%s %s=%d %s=%u wrvar missing value to write for variable %s Bad value: %s for variable %s Error %d writing the srom get version informationcmdsgenerate a short list of available commandsreinitialize and mark adapter up (operational)reset and mark adapter down (disabled)mark adapter down but do not reset hardware(disabled) On dualband cards, cards must be bandlocked before use.clkset board clock state. return error for set_clk attempt if the driver is not down 0: clock off 1: clock onrestartRestart driver. Driver must already be down.rebootReboot platformSet the radio on or off. "on" or "off"Give suboption "list" to list various suboptionsClear the sromsrdumpprint contents of SPROM to stdoutsrwriteWrite the srom: srwrite byteoffset valueGet the CRC for input binary fileWrite specified to the SDIO CIS source (either SROM or OTP)Display the content of the SDIO CIS source Display which source is used for the SDIO CISPrint CIS tuple for given name=value pairRead a named variable to the sromWrite a named variable to the sromnvram_sourceDisplay which source is used for nvramprint nvram variables to stdoutset an nvram variable name=value (no spaces around '=')nvgetget the value of an nvram variablerevinfoget hardware revision informationcustomvar1print the value of customvar1 in hex formatset driver console debugging message bitvector type 'wl msglevel ?' for valuesPMset driver power management mode: 0: CAM (constantly awake) 1: PS (power-save) 2: FAST PS modewakeset driver power-save mode sleep state: 0: core-managed 1: awakepromiscset promiscuous mode ethernet address reception 0 - disable 1 - enablemonitorset monitor mode 0 - disable 1 - enable active monitor mode (interface still operates)fragDeprecated. Use fragthresh.rtsDeprecated. Use rtsthresh.cwminSet the cwmin. (integer [1, 255])cwmaxSet the cwmax. (integer [256, 2047])srlSet the short retry limit. (integer [1, 255])lrlSet the long retry limit. (integer [1, 255])force a fixed rate: valid values for 802.11a are (6, 9, 12, 18, 24, 36, 48, 54) valid values for 802.11b are (1, 2, 5.5, 11) valid values for 802.11g are (1, 2, 5.5, 6, 9, 11, 12, 18, 24, 36, 48, 54) -1 (default) means automatically determine the best ratemrateforce a fixed multicast rate: valid values for 802.11a are (6, 9, 12, 18, 24, 36, 48, 54) valid values for 802.11b are (1, 2, 5.5, 11) valid values for 802.11g are (1, 2, 5.5, 6, 9, 11, 12, 18, 24, 36, 48, 54) -1 (default) means automatically determine the best ratea_rateforce a fixed rate for the A PHY: valid values for 802.11a are (6, 9, 12, 18, 24, 36, 48, 54) -1 (default) means automatically determine the best ratea_mrateforce a fixed multicast rate for the A PHY: valid values for 802.11a are (6, 9, 12, 18, 24, 36, 48, 54) -1 (default) means automatically determine the best ratebg_rateforce a fixed rate for the B/G PHY: valid values for 802.11b are (1, 2, 5.5, 11) valid values for 802.11g are (1, 2, 5.5, 6, 9, 11, 12, 18, 24, 36, 48, 54) -1 (default) means automatically determine the best ratebg_mrateforce a fixed multicast rate for the B/G PHY: valid values for 802.11b are (1, 2, 5.5, 11) valid values for 802.11g are (1, 2, 5.5, 6, 9, 11, 12, 18, 24, 36, 48, 54) -1 (default) means automatically determine the best rateSet Infrastructure mode: 0 (IBSS) or 1 (Infra BSS)Set AP mode: 0 (STA) or 1 (AP)Get the BSSID value, error if STA and not associatedbssmaxget number of BSSes Set the channel: valid channels for 802.11b/g (2.4GHz band) are 1 through 14 valid channels for 802.11a (5 GHz band) are: 36, 40, 44, 48, 52, 56, 60, 64, 100, 104, 108, 112, 116,120, 124, 128, 132, 136, 140, 149, 153, 157, 161, 184, 188, 192, 196, 200, 204, 208, 212, 216Get the current mcs setGet all the valid chanspecs (default: all within current locale): -b band (5(a) or 2(b/g)) -w bandwidth, 10,20 or 40 [-c country_abbrev] Set [a,b][n][u,l] channel number (0-224) band a=5G, b=2G, default to 2G if channel <= 14 bandwidth, n=10, none for 20 & 40 ctl sideband, l=lower, u=upper OR Set channel with legacy format: -c channel number (0-224) -b band (5(a) or 2(b/g)) -w bandwidth, 10,20 or 40 -s ctl sideband, -1=lower, 0=none, 1=upperdfs_channel_forcedSet [a,b][n][u,l] channel number (0-224) band a=5G, b=2G, default to 2G if channel <= 14 bandwidth, n=10, non for 20 & 40 ctl sideband, l=lower, u=upper tssiGet the tssi value from radiotxpwrSet tx power in milliwatts. Range [1, 84].txpwr1Set tx power in in various units. Choose one of (default: dbm): -d dbm units -q quarter dbm units -m milliwatt units Can be combined with: -o turn on override to disable regulatory and other limitations Use wl txpwr -1 to restore defaultstxpathpwrTurn the tx path power on or off on 2050 radiostxpwrlimitReturn current tx power limitpowerindexSet the transmit power for A band(0-63). -1 - default valueattenSet the transmit attenuation for B band. Args: bb radio txctl1. auto to revert to automatic control manual to supspend automatic controlphyregGet/Set a phy register: offset [ value ] [ band ]Get/Set a radio register: offset [ value ] [ band/core ]ucflagsGet/Set ucode flags 1, 2, 3(16 bits each) offset [ value ] [ band ]shmemGet/Set a shared memory location: offset [ value ] [band ]macregGet/Set any mac registers(include IHR and SB): macreg offset size[2,4] [ value ] [ band ]ucantdivEnable/disable ucode antenna diversity (1/0 or on/off)Set any GPIO pins to any value. Use with caution as GPIOs would be assigned to chipcommon Usage: gpiomask gpiovalpcieserdesregg/set SERDES registers: dev offset [val]enable/disable per-tid ampdu; usage: wl ampdu_tid [0/1]Set per-tid ampdu retry limit; usage: wl ampdu_retry_limit_tid [0~31]Set per-tid ampdu regular rate retry limit; usage: wl ampdu_rr_retry_limit_tid [0~31]send addba to specified ea-tid; usage: wl ampdu_send_addba send delba to specified ea-tid; usage: wl ampdu_send_delba ampdu_clear_dumpclear ampdu countersadds/removes ea to dpt deny list usage: wl dpt_deny creates/updates/deletes dpt endpoint for ea usage: wl dpt_endpoint sets DPT pre-shared keysets/gets DPT friendly namedpt_listgets status of all dpt peerscarries HCI subcommands to the driver usage: wl HCI_cmd antdivSet antenna diversity for rx 0 - force use of antenna 0 1 - force use of antenna 1 3 - automatic selection of antenna diversitytxantSet the transmit antenna 0 - force use of antenna 0 1 - force use of antenna 1 3 - use the RX antenna selection that was in force during the most recently received good PLCP headerplcphdrSet the plcp header. "long" or "auto" or "debug"phytypeGet phy typerateparamset driver rate selection tunables arg 1: tunable id arg 2: tunable valuewepstatusSet or Get WEP status wepstatus [on|off]primary_keySet or get index of primary keySet an encryption key. The key must be 5, 13 or 16 bytes long, or 10, 26, 32, or 64 hex digits long. The encryption algorithm is automatically selected based on the key size. keytype is accepted only when key length is 16 bytes/32 hex digits and specifies whether AES-OCB or AES-CCM encryption is used. Default is ccm. addwep [ocb | ccm] [notx] [xx:xx:xx:xx:xx:xx]Remove the encryption key at the specified key index.keysPrints a list of the current WEP keystscPrint Tx Sequence Couter for key at specified key index.wsec_testGenerate wsec errors wsec_test type 'wl wsec_test ?' for test_typestkip_countermeasuresEnable or disable TKIP countermeasures (TKIP-enabled AP only) 0 - disable 1 - enablewsec_restrictDrop unencrypted packets if WSEC is enabled 0 - disable 1 - enableeaprestrict traffic to 802.1X packets until 802.1X authorization succeeds 0 - disable 1 - enablecur_etheraddrGet/set the current hw addressperm_etheraddrGet the permanent address from NVRAMauthorizerestrict traffic to 802.1X packets until 802.1X authorization succeedsdeauthorizedo not restrict traffic to 802.1X packets until 802.1X authorization succeedsdeauthenticatedeauthenticate a STA from the AP with optional reason code (AP ONLY)wireless security bit vector 1 - WEP enabled 2 - TKIP enabled 4 - AES enabled 8 - WSEC in software 0x80 - FIPS enabledset/get 802.11 authentication type. 0 = OpenSystem, 1= SharedKeyBitvector of WPA authorization modes: 1 WPA-NONE 2 WPA-802.1X/WPA-Professional 4 WPA-PSK/WPA-Personal 64 WPA2-802.1X/WPA2-Professional 128 WPA2-PSK/WPA2-Personal 0 disable WPAwpa_capset/get 802.11i RSN capabilitiesset_pmkSet passphrase for PMK in driver-resident supplicant.Initiate a scan. Default to an active scan across all channels for any SSID. Optional arg: SSID, the SSID to scan. Options: -s S, --ssid=S SSID to scan -t ST, --scan_type=ST [active|passive] scan type --bss_type=BT [bss/infra|ibss/adhoc] bss type to scan -b MAC, --bssid=MAC particular BSSID MAC address to scan, xx:xx:xx:xx:xx:xx -n N, --nprobes=N number of probes per scanned channel -a N, --active=N dwell time per channel for active scanning -p N, --passive=N dwell time per channel for passive scanning -h N, --home=N dwell time for the home channel between channel scans -c L, --channels=L comma or space separated list of channels to scanInitiate an incremental scan. Default to an active scan across all channels for any SSID. Optional arg: SSID, the SSID to scan. Options: -s S, --ssid=S SSID to scan -t ST, --scan_type=ST [active|passive] scan type --bss_type=BT [bss/infra|ibss/adhoc] bss type to scan -b MAC, --bssid=MAC particular BSSID MAC address to scan, xx:xx:xx:xx:xx:xx -n N, --nprobes=N number of probes per scanned channel -a N, --active=N dwell time per channel for active scanning -p N, --passive=N dwell time per channel for passive scanning -h N, --home=N dwell time for the home channel between channel scans -c L, --channels=L comma or space separated list of channels to scanContinue an incremental scan. Default to an active scan across all channels for any SSID. Optional arg: SSID, the SSID to scan. Options: -s S, --ssid=S SSID to scan -t ST, --scan_type=ST [active|passive] scan type --bss_type=BT [bss/infra|ibss/adhoc] bss type to scan -b MAC, --bssid=MAC particular BSSID MAC address to scan, xx:xx:xx:xx:xx:xx -n N, --nprobes=N number of probes per scanned channel -a N, --active=N dwell time per channel for active scanning -p N, --passive=N dwell time per channel for passive scanning -h N, --home=N dwell time for the home channel between channel scans -c L, --channels=L comma or space separated list of channels to scanscancache_clearclear the scan cachePuts scan engine into passive moderegulatoryGet/Set regulatory domain mode (802.11d). Driver must be down.spectGet/Set 802.11h Spectrum Management mode. 0 - Off 1 - Loose interpretation of 11h spec - may join non-11h APs 2 - Strict interpretation of 11h spec - may not join non-11h APs 3 - Disable 11h and enable 11d 4 - Loose interpretation of 11h+d spec - may join non-11h APsscanresultsReturn results from last scan.Return results from last iscan. Specify a buflen (max 8188) to artificially limit the size of the results buffer. iscanresults [buflen] Print information about current network association. (also known as "status")Print information about current network association. (also known as "assoc")disassocDisassociate from the current BSS/IBSS.chanlistDeprecated. Use channels.Return valid channels for the current settings.channels_in_countryReturn valid channels for the country specified. Arg 1 is the country abbreviation Arg 2 is the band(a or b)curpowerReturn current tx power settings. -q (quiet): estimated power only.Return tx power based on instant TSSI scansuppressSuppress all scans for testing. 0 - allow scans 1 - suppress scansevmStart an EVM test on the given channel, or stop EVM test. Arg 1 is channel number 1-14, or "off" or 0 to stop the test. Arg 2 is optional rate (1, 2, 5.5 or 11)ratesetReturns or sets the supported and basic rateset, (b) indicates basic With no args, returns the rateset. Args are rateset "default" | "all" | default - driver defaults all - all rates are basic rates arbitrary rateset - list of rates List of rates are in Mbps and each rate is optionally followed by "(b)" or "b" for a Basic rate. Example: 1(b) 2b 5.5 11 At least one rate must be Basic for a legal rateset.roam_triggerGet or Set the roam trigger RSSI threshold: Get: roam_trigger [a|b] Set: roam_trigger [a|b|all] integer - 0: default 1: optimize bandwidth 2: optimize distance [-1, -99]: dBm trigger valueroam_deltaSet the roam candidate qualification delta. roam_delta [integer [, a/b]]roam_scan_periodSet the roam candidate qualification delta. (integer)supratesReturns or sets the 11g override for the supported rateset With no args, returns the rateset. Args are a list of rates, or 0 or -1 to specify an empty rateset to clear the override. List of rates are in Mbps, example: 1 2 5.5 11scan_channel_timeGet/Set scan channel timescan_unassoc_timeGet/Set unassociated scan channel dwell timescan_home_timeGet/Set scan home channel dwell timescan_passive_timeGet/Set passive scan channel dwell timescan_nprobesGet/Set scan parameter for number of probes to use per channel scannedprb_resp_timeoutGet/Set probe response timeoutchannel_qaGet last channel quality measurmentchannel_qa_startStart a channel quality measurmentSelect Country Code for driver operational region For simple country setting: wl country Where is either a long name or country code from ISO 3166; for example "Germany" or "DE" For a specific built-in country definition: wl country [] Where is a country country code followed by '/' and regulatory revision number. For example, "US/3". And where is either a long name or country code from ISO 3166. If is omitted, it will be the same as the built-in country code. Use 'wl country list [band(a or b)]' for the list of supported countriesautocountry_defaultSelect Country Code for use with Auto Contry DiscoveryjoinJoin a specified network SSID. Usage: join [key <0-3>:xxxxx] [imode bss|ibss] [amode open|shared|wpa|wpapsk|wpa2|wpa2psk|wpanone] [options] Options: -b MAC, --bssid=MAC BSSID (xx:xx:xx:xx:xx:xx) to scan and join -c CL, --chanspecs=CL chanspecs (comma or space separated list)Set or get a configuration's SSID. wl ssid [-C num]|[--cfg=num] [] If the configuration index 'num' is not given, configuraion #0 is assumed and setting will initiate an assoication attempt if in infrastructure mode, or join/creation of an IBSS if in IBSS mode, or creation of a BSS if in AP mode.Set or get the list of source MAC address matches. wl mac xx:xx:xx:xx:xx:xx [xx:xx:xx:xx:xx:xx ...] To Clear the list: wl mac nonemacmodeSet the mode of the MAC list. 0 - Disable MAC address matching. 1 - Deny association to stations on the MAC list. 2 - Allow association to stations on the MAC list.Set or get the list of WDS member MAC addresses. Set using a space separated list of MAC addresses. wl wds xx:xx:xx:xx:xx:xx [xx:xx:xx:xx:xx:xx ...]lazywdsSet or get "lazy" WDS mode (dynamically grant WDS membership to anyone).noiseGet noise (moving average) right after tx in dBmfqacurcyManufacturing test: set frequency accuracy mode. freqacuracy syntax is: fqacurcy Arg is channel number 1-14, or 0 to stop the test.crsuprsManufacturing test: set carrier suppression mode. carriersuprs syntax is: crsuprs Arg is channel number 1-14, or 0 to stop the test.longtrainManufacturing test: set longtraining mode. longtrain syntax is: longtrain Arg is A band channel number or 0 to stop the test.Returns or sets the current band auto - auto switch between available bands (default) a - force use of 802.11a band b - force use of 802.11b bandReturn the list of available 802.11 bandsphylistReturn the list of available phytypesshortslotGet current 11g Short Slot Timing mode. (0=long, 1=short)shortslot_overrideGet/Set 11g Short Slot Timing mode override. (-1=auto, 0=long, 1=short)shortslot_restrictGet/Set AP Restriction on associations for 11g Short Slot Timing capable STAs. 0 - Do not restrict association based on ShortSlot capability 1 - Restrict association to STAs with ShortSlot capabilityignore_bcnsAP only (G mode): Check for beacons without NONERP element(0=Examine beacons, 1=Ignore beacons)pktcntGet the summary of good and bad packets.upgradeUpgrade the firmware on an embedded devicegmodeSet the 54g Mode (LegacyB|Auto||GOnly|BDeferred|Performance|LRS)gmode_protectionGet G protection mode. (0=disabled, 1=enabled)gmode_protection_controlGet/Set 11g protection mode control alg.(0=always off, 1=monitor local association, 2=monitor overlapping BSS)gmode_protection_overrideGet/Set 11g protection mode override. (-1=auto, 0=disable, 1=enable)protection_controlGet/Set protection mode control alg.(0=always off, 1=monitor local association, 2=monitor overlapping BSS)legacy_erpGet/Set 11g legacy ERP inclusion (0=disable, 1=enable)scb_timeoutAP only: inactivity timeout value for authenticated stasassoclistAP only: Get the list of associated MAC addresses.isupGet driver operational state (0=down, 1=up)rssiGet the current RSSI val, for an AP you must specify the mac addr of the STAphy_rssi_antGet RSSI per antenna (only gives RSSI of current antenna for SISO PHY) fasttimerDeprecated. Use fast_timer.slowtimerDeprecated. Use slow_timer.glacialtimerDeprecated. Use glacial_timer.radarEnable/Disable radarradarargsGet/Set Radar parameters in order as version, npulses, ncontig, min_pw , max_pw, thresh0, thresh1, blank, fmdemodcfg, npulses_lp, min_pw_lp, max_pw_lp, min_fm_lp, max_span_lp, min_deltat, max_deltat, autocorr, st_level_time, t2_min, fra_pulse_err, npulses_fra, npulses_stg2, npulses_stg3, percal_mask, quant, min_burst_intv_lp, max_burst_intv_lp, nskip_rst_lp, max_pw_tol, feature_mask radarargs40Get/Set Radar parameters for 40Mhz channel in order as version, npulses, ncontig, min_pw , max_pw, thresh0, thresh1, blank, fmdemodcfg, npulses_lp, min_pw_lp, max_pw_lp, min_fm_lp, max_span_lp, min_deltat, max_deltat, autocorr, st_level_time, t2_min, fra_pulse_err, npulses_fra, npulses_stg2, npulses_stg3, percal_mask, quant, min_burst_intv_lp, max_burst_intv_lp, nskip_rst_lp, max_pw_tol, feature_mask radarthrsSet Radar threshold for both 20 & 40MHz BW: order as thresh0_20_lo, thresh1_20_lo, thresh0_40_lo, thresh1_40_lo thresh0_20_hi, thresh1_20_hi, thresh0_40_hi, thresh1_40_hi dfs_statusGet dfs statusinterferenceGet/Set interference mitigation mode. Choices are: 0 = none 1 = non wlan 2 = wlan manual 3 = wlan automatic 4 = wlan automatic with noise reductionframeburstDisable/Enable frameburst modepwr_percentGet/Set power output percentagetoeEnable/Disable tcpip offload featureGet/Set tcpip offload componentstoe_statsDisplay checksum offload statisticstoe_stats_clearClear checksum offload statisticsarpoeEnable/Disable arp agent offload featureGet/Set arp offload componentsarp_peerageGet/Set age of the arp entry in minutesarp_table_clearClear arp cachearp_hostipAdd a host-ip address or display themarp_hostip_clearClear all host-ip addressesarp_statsDisplay ARP offload statisticsarp_stats_clearClear ARP offload statisticswetGet/Set wireless ethernet bridging modebiGet/Set the beacon period (bi=beacon interval)dtimGet/Set DTIMwds_remote_macGet WDS link remote endpoint's MAC addresswds_wpa_role_oldGet WDS link local endpoint's WPA role (old)Get/Set WDS link local endpoint's WPA roleauthe_sta_listGet authenticated sta mac address listautho_sta_listGet authorized sta mac address listmeasure_reqSend an 802.11h measurement request. Usage: wl measure_req Measurement types are: TPC, Basic, CCA, RPI Target MAC addr format is xx:xx:xx:xx:xx:xxquietSend an 802.11h quiet command. Usage: wl quiet , , csaSend an 802.11h channel switch anouncement with chanspec: [a,b][n][u,l] mode (0 or 1) count (0-254) channel number (0-224) band a=5G, b=2G bandwidth n=10, non for 20 & 40 ctl sideband, l=lower, u=upper, default no ctl sideband constraintSend an 802.11h Power Constraint IE Usage: wl constraint 1-255 dbRequest a radio measurement of type basic, cca, or rpi specify a series of measurement types each followed by options. example: wl rm_req cca -c 1 -d 50 cca -c 6 cca -c 11 Options: -t n numeric token id for measurement set or measurement -c n channel -d n duration in TUs (1024 us) -p parallel flag, measurement starts at the same time as previous Each measurement specified uses the same channel and duration as the previous unless a new channel or duration is specified.Get current radio measurement reportSet/Get join target preferences.assoc_prefSet/Get association preference. Usage: wl assoc_pref [auto|a|b|g]wmeSet WME (Wireless Multimedia Extensions) mode (0=off, 1=on, -1=auto)wme_acwl wme_ac ap|sta [be|bk|vi|vo [ecwmax|ecwmin|txop|aifsn|acm ] ...]wme_apsdSet APSD (Automatic Power Save Delivery) mode on AP (0=off, 1=on)wme_apsd_staSet APSD parameters on STA. Driver must be down. Usage: wl wme_apsd_sta : number of frames per USP: 0 (all), 2, 4, or 6 : value 0 to disable, 1 to enable U-APSD per ACSet AC queue discard policy. Usage: wl wme_dp : value 0 for newest-first, 1 for oldest-firstwme_countersprint WMM statswme_clear_countersclear WMM counterswl wme_tx_params [be|bk|vi|vo [short|sfb|long|lfb|max_rate ] ...]wl wme_maxbw_params [be|bk|vi|vo ....]Set Lifetime parameter (milliseconds) for each ac. wl lifetime be|bk|vi|vo []reinitReinitialize devicewl sta_info nphy_test_tssiwl nphy_test_tssi valnphy_test_tssi_offswl nphy_test_tssi_offs valwl nphy_rssiant antindex(0-3)driver capabilitiesmalloc_dumpDeprecated. Folded under 'wl dump mallocchannel infoadd_ieAdd a vendor proprietary IE to 802.11 management packets Usage: wl add_ie length OUI hexdata : Bit 0 - Beacons Bit 1 - Probe Rsp Bit 2 - Assoc/Reassoc Rsp Bit 3 - Auth Rsp Bit 4 - Probe Req Bit 5 - Assoc/Reassoc Req Example: wl add_ie 3 10 00:90:4C 0101050c121a03 to add this IE to beacons and probe responsesdel_ieDelete a vendor proprietary IE from 802.11 management packets Usage: wl del_ie length OUI hexdata : Bit 0 - Beacons Bit 1 - Probe Rsp Bit 2 - Assoc/Reassoc Rsp Bit 3 - Auth Rsp Bit 4 - Probe Req Bit 5 - Assoc/Reassoc Req Example: wl del_ie 3 10 00:90:4C 0101050c121a03list_ieDump the list of vendor proprietary IEsrandGet a 2-byte Random Number from the MAC's PRNG Usage: wl randotpwWrite an srom image to on-chip otp Usage: wl otpw filenvotpwWrite nvram to on-chip otp Usage: wl nvotpw fileerrorstringfreqtrackSet Frequency Tracking Mode (0=Auto, 1=On, 2=OFF)eventingset/get 128-bit hex filter bitmask for MAC event reporting up to application layerevent_msgsset/get 128-bit hex filter bitmask for MAC event reporting via packet indicationsReturn driver counter valuesdelta_stats_intervalset/get the delta statistics interval in seconds (0 to disable)delta_statsget the delta statistics for the last intervalassoc_infoReturns the assoc req and resp information [STA only]autochannelauto channel selection: 1 to issue a channel scanning; 2 to set chanspec based on the channel scan result; without argument to only show the chanspec selected; ssid must set to null before this process, RF must be upcsscantimerauto channel scan timer in minutes (0 to disable)closedhides the network from active scans, 0 or 1. 0 is open, 1 is hidepmkid_infoReturns the pmkid tableabminrateget/set afterburner minimum rate thresholdset/get BSS enabled status: up/downclosednetset/get BSS closed network attributeap_isolateset/get AP isolationeap_restrictset/get EAP restrictiondiag testindex(1-interrupt, 2-loopback, 3-memory, 4-led); precede by 'wl down' and follow by 'wl up'reset_d11cntsreset 802.11 MIB countersstanameget/set station name: Maximum name length is 15 bytesapnameget AP nameotpdumpDump raw otp-r legacy rate (CCK, OFDM)-m mcs index-s stf mode (0=SISO,1=CDD,2=STBC(not supported),3=SDM)mimo_txbwget/set mimo txbw (2=20Mhz(lower), 3=20Mhz upper, 4=40Mhz, 5=40Mhz dup[AUTO] [AUTO] [AUTO] [AUTO] where utx = TX unicast antenna configuration urx = RX unicast antenna configuration dtx = TX default (non-unicast) antenna configuration drx = RX default (non-unicast) antenna configuration Do ADC sample collect. Works for NPHY phyrevs >= 3. Optional parameters are: File name to dump the sample buffer (binary format, default "sample_collect.dat") Sample collect duration in us (default 60) Cores to do sample collect, only if BW=40MHz (default both) The buffer returned has the format: In 20MHz [(uint16)num_bytes, ] In 40MHz [(uint16)num_bytes(core0), , (uint16)num_bytes(core1), ] set/get the txfifo size; usage: wl txfifo_sz phy_rxiqestGet phy RX IQ noise in dBm: -s # of samples (2^n) -a antenna select, 0,1 or 3 rifsset/get the rifs status; usage: wl rifs <1/0> (On/Off) start packet engine; usage: wl pkteng_start [ipg] [len] [nframes] [src] ipg: inter packet gap in us len: packet length nframes: number of frames; 0 indicates continuous tx test stop packet engine; usage: wl pkteng_stop pkteng_statspacket engine stats; usage: wl pkteng_statswowlEnable/disable WOWL events 0 - Clear all events Bit 0 - Wakeup on Magic Packet Bit 1 - Wakeup on NetPattern (use 'wl wowl_pattern' to configure pattern) Bit 2 - Wakeup on loss-of-link due to Disassociation/Deauth Bit 3 - Wakeup on retrograde tsf Bit 4 - Wakeup on loss of beacon (use 'wl wowl_bcn_loss' to configure time) wowl_bcn_lossSet #of seconds of beacon loss for wakeup event usage: wowl_pattern [ [clr | [[ add | del ] offset mask value ]]] No options -- lists existing pattern list add -- Adds the pattern to the list del -- Removes a pattern from the list clr -- Clear current list offset -- Starting offset for the pattern mask -- Mask to be used for pattern. Bit i of mask => byte i of the pattern value -- Value of the pattern usage: wowl_wakeind [clear] Shows last system wakeup event indications from PCI and D11 cores clear - Clear the indications usage: wowl_status [clear] Shows last system wakeup setting print papd eps table; Usage: wl lpphy_papdepstbllpphy_txiqccusage: lpphy_txiqcc [a b] Set/get the iqcc a, b values usage: lpphy_txlocc [di dq ei eq fi fq] Set/get locc di dq ei eq fi fq values phytableusage: wl phytable table_id offset width_of_table_element [table_element] Set/get table element of a table with the given ID at the given offset Note that table width supplied should be 8 or 16 or 32 table ID, table offset can not be -ve pavarsSet/get temp PA parameters usage: wl down wl pavars pa2gw0a0=0x1 pa2gw1a0=0x2 pa2gw2a0=0x3 ... wl pavars wl up override the PA parameters after driver attach(srom read), before diver up These override values will be propogated to HW when driver goes up PA parameters in one band range (2g, 5gl, 5g, 5gh) must all present if one of them is specified in the command, otherwise it will be filled with 0 povarsSet/get temp power offset usage: wl down wl povars cck2gpo=0x1 ofdm2gpo=0x2 mcs2gpo=0x3 ... wl povars wl up override the power offset after driver attach(srom read), before diver up These override values will be propogated to HW when driver goes up power offsets in one band range (2g, 5gl, 5g, 5gh) must all present if one of them is specified in the command, otherwise it will be filled with 0 cck(2g only), ofdm, and mcs(0-7) for NPHY are supported femSet temp fem2g/5g value usage: wl fem (tssipos2g=0x1 extpagain2g=0x2 pdetrange2g=0x1 triso2g=0x1 antswctl2g=0) (tssipos5g=0x1 extpagain5g=0x2 pdetrange5g=0x1 triso5g=0x1 antswctl5g=0) Set temp ag0/1 value usage: wl antgain ag0=0x1 ag1=0x2 Set temp maxp2g(5g)a0(a1) value usage: wl maxpower maxp2ga0=0x1 maxp2ga1=0x2 maxp5ga0=0xff maxp5ga1=0xff maxp5gla0=0x3 maxp5gla1=0x4 maxp5gha0=0x5 maxp5gha1=0x6 Send a wakeup frame to wakup a sleeping STA in WAKE mode Usage: wl wowl_pkt >[ magic [] | net ] e.g. To send bcast magic frame -- wl wowl_pkt 102 bcast magic 00:90:4c:AA:BB:CC To send ucast magic frame -- wl wowl_pkt 102 ucast 00:90:4c:aa:bb:cc magic To send a frame with L2 unicast - wl wowl_pkt 102 00:90:4c:aa:bb:cc net 0 0x00904caabbcc NOTE: offset for netpattern frame starts from "Dest EA" of ethernet frame.So dest ea will be used only when offset is >= 6 wme_apsd_triggerSet Periodic APSD Trigger Frame Timer timeout in ms (0=off)wme_autotriggerEnable/Disable sending of APSD Trigger frame when all ac are delivery enabledreassocInitiate a (re)association request. Usage: wl reassoc [options] Options: -c CL, --chanspecs=CL chanspecs (comma or space separated list)send_nulldataSed a null frame to the specified hw addressbtc_paramsg/set BT Coex parametersbtc_flagsg/set BT Coex flagsobss_scan_paramsset/get Overlapping BSS scan parameters Usage: wl obss_scan a b c d e ...; where a-Passive Dwell, {5-1000TU}, default = 100 b-Active Dwell, {10-1000TU}, default = 20 c-Width Trigger Scan Interval, {10-900sec}, default = 300 d-Passive Total per Channel, {200-10000TU}, default = 200 e-Active Total per Channel, {20-1000TU}, default = 20 f-Channel Transition Delay Factor, {5-100}, default = 5 g-Activity Threshold, {0-100%}, default = 25 Send specified "keep-alive" packet periodically. Usage: wl keep_alive period: Re-transmission period in milli-seconds. 0 to disable packet transmits. packet: Hex packet contents to transmit. The packet contents should include the entire ethernet packet (ethernet header, IP header, UDP header, and UDP payload) specified in network byte order. e.g. Send keep alive packet every 30 seconds: wl keep_alive 30000 0x0014a54b164f000f66f45b7e08004500001e000040004011c52a0a8830700a88302513c413c4000a00000a0d srchmemg/set ucode srch engine memoryInstall a packet filter. Usage: wl pkt_filter_add id: Integer. User specified id. type: 0 (Pattern matching filter). offset: Integer. Offset within received packets to start matching. polarity: Set to 1 to negate match result. 0 is default. bitmask: Hex bitmask that indicates which bits of 'pattern' to match. Must be same size as 'pattern'. Bit 0 of bitmask corresponds to bit 0 of pattern, etc. If bit N of bitmask is 0, then do *not* match bit N of the pattern with the received payload. If bit N of bitmask is 1, then perform match. pattern: Hex pattern to match. pkt_filter_clear_statsClear packet filter statistic counter values. Usage: wl pkt_filter_clear_stats pkt_filter_enableEnable/disable a packet filter. Usage: wl pkt_filter_enable <0|1> pkt_filter_listList installed packet filters. Usage: wl pkt_filter_list [val] val: 0 (disabled filters) 1 (enabled filters) pkt_filter_modeSet packet filter match action. Usage: wl pkt_filter_mode value: 0 - Forward packet on match, discard on non-match (default). 1 - Discard packet on match, forward on non-match. pkt_filter_deleteUninstall a packet filter. Usage: wl pkt_filter_delete pkt_filter_statsRetrieve packet filter statistic counter values. Usage: wl pkt_filter_stats Initiates command batching sequence. Subsequent IOCTLs will be queued until seq_stop is received.Defines the end of command batching sequence. Queued IOCTLs will be executed.seq_delayDriver should spin for the indicated amount of time. It is only valid within the context of batched commands.seq_error_indexUsed to retrieve the index (starting at 1) of the command that failed within a batchbmac_rebootReboot BMACtxmcssetget Transmit MCS rateset for 11N devicerxmcssetget Receive MCS rateset for 11N devicemimo_ss_stfg/set SS STF mode. Usage: wl mimo_ss_stf <-b a | b> value: 0 - SISO; 1 - CDD -b(band): a - 5G; b - 2.4GassoclistinfoAP only: Get the list of yet another form of associated station infoWileless LED Usage: wl led pin func polarity {ledon_period ledoff_period} func selection: 2 - activity 4 - A radio 5 - B radio 32 - off 33 - on 34 - blink Example: wl led 0 34 0 50 40 Turn GPIO0 LED blink with 50ms and off 40 ms scblistAP only: Get STA listassertlogget external assert logs Usage: wl assertlog assert_bypassset/get the asset_bypass flag; usage: wl assert_bypass <1/0> (On/Off) obss_coex_actionsend OBSS 20/40 Coexistence Mangement Action Frame Usage: wl obss_coex_action -i <1/0> -w <1/0> -c -i: 40MHz intolerate bit; -w: 20MHz width Req bit; -c: channel list, 1 - 14 At least one option must be provided ledbhset/get led behavior Usage: wl ledbh [0-3] [0-15] varunrecognized name, type -h for helpAFGHANISTANAFALBANIAALALGERIADZAMERICAN SAMOAASANDORRAADANGOLAAOANGUILLAAIANTARCTICAAQANTIGUA AND BARBUDAAGARGENTINAARMENIAAMARUBAAWASCENSION ISLANDAUSTRALIAAUAUSTRIAAZERBAIJANAZBAHAMASBSBAHRAINBHBANGLADESHBDBARBADOSBBBELARUSBYBELGIUMBEBELIZEBZBENINBJBERMUDABMBHUTANBTBOLIVIABOBOSNIA AND HERZEGOVINABABOTSWANABWBOUVET ISLANDBVBRAZILBRBRITISH INDIAN OCEAN TERRITORYIOBRUNEI DARUSSALAMBNBULGARIABGBURKINA FASOBFBURUNDIBICAMBODIAKHCAMEROONCMCANADACAPE VERDECVCAYMAN ISLANDSKYCENTRAL AFRICAN REPUBLICCFCHADTDCHILECLCNCHRISTMAS ISLANDCXCLIPPERTON ISLANDCPCOCOS (KEELING) ISLANDSCCCOLOMBIACOMOROSKMCONGOCGCONGO, THE DEMOCRATIC REPUBLIC OF THECDCOOK ISLANDSCKCOSTA RICACRCOTE D'IVOIRECICROATIAHRCUBACUCYPRUSCYCZECH REPUBLICCZDENMARKDKDJIBOUTIDJDOMINICADMDOMINICAN REPUBLICDOECUADORECEGYPTEGEL SALVADORSVEQUATORIAL GUINEAGQERITREAERESTONIAEEETHIOPIAETFALKLAND ISLANDS (MALVINAS)FKFAROE ISLANDSFIJIFJFINLANDFIFRANCEFRFRENCH GUIANAGFFRENCH POLYNESIAPFFRENCH SOUTHERN TERRITORIESTFGABONGAGAMBIAGMGEORGIAGEGERMANYGHANAGHGIBRALTARGIGREECEGRGREENLANDGLGRENADAGDGUADELOUPEGPGUAMGUGUATEMALAGTGUERNSEYGGGUINEAGNGUINEA-BISSAUGWGUYANAGYHAITIHTHEARD ISLAND AND MCDONALD ISLANDSHMHOLY SEE (VATICAN CITY STATE)VAHONDURASHNHONG KONGHKHUNGARYHUICELANDISINDIAININDONESIAIDIRAN, ISLAMIC REPUBLIC OFIRIRAQIQIRELANDIEISRAELITALYJAMAICAJMJAPANJPJERSEYJEJORDANJOKAZAKHSTANKZKENYAKEKIRIBATIKIKOREA, DEMOCRATIC PEOPLE'S REPUBLIC OFKPKOREA, REPUBLIC OFKRKUWAITKWKYRGYZSTANKGLAO PEOPLE'S DEMOCRATIC REPUBLICLATVIALVLEBANONLBLESOTHOLIBERIALRLIBYAN ARAB JAMAHIRIYALYLIECHTENSTEINLILITHUANIALTLUXEMBOURGMACAOMOMACEDONIA, THE FORMER YUGOSLAV REPUBLIC OFMKMADAGASCARMGMALAWIMWMALAYSIAMYMALDIVESMVMALIMLMALTAMTMAN, ISLE OFIMMARSHALL ISLANDSMHMARTINIQUEMQMAURITANIAMRMAURITIUSMUMAYOTTEYTMEXICOMXMICRONESIA, FEDERATED STATES OFFMMOLDOVA, REPUBLIC OFMDMONACOMCMONGOLIAMNMONTENEGROMEMONTSERRATMSMOROCCOMOZAMBIQUEMZMYANMARMMNAMIBIANAURUNRNEPALNPNETHERLANDSNLNETHERLANDS ANTILLESNEW CALEDONIANCNEW ZEALANDNZNICARAGUANINIGERNENIGERIANGNIUENUNORFOLK ISLANDNFNORTHERN MARIANA ISLANDSMPNORWAYOMANPAKISTANPKPALAUPWPALESTINIAN TERRITORY, OCCUPIEDPSPANAMAPAPAPUA NEW GUINEAPGPARAGUAYPYPERUPHILIPPINESPHPITCAIRNPNPOLANDPLPORTUGALPTPUERTO RICOPRQATARQAREUNIONREROMANIARUSSIAN FEDERATIONRURWANDARWSAINT HELENASAINT KITTS AND NEVISKNSAINT LUCIALCSAINT PIERRE AND MIQUELONSAINT VINCENT AND THE GRENADINESVCSAMOAWSSAN MARINOSMSAO TOME AND PRINCIPESTSAUDI ARABIASASENEGALSNSERBIARSSEYCHELLESSCSIERRA LEONESLSINGAPORESGSLOVAKIASKSLOVENIASISOLOMON ISLANDSSBSOMALIASOUTH AFRICAZASOUTH GEORGIA AND THE SOUTH SANDWICH ISLANDSGSSPAINSRI LANKALKSUDANSURINAMESRSVALBARD AND JAN MAYENSJSWAZILANDSZSWEDENSESWITZERLANDCHSYRIAN ARAB REPUBLICSYTAIWAN, PROVINCE OF CHINATWTAJIKISTANTJTANZANIA, UNITED REPUBLIC OFTZTHAILANDTHTIMOR-LESTE (EAST TIMOR)TLTOGOTGTOKELAUTKTONGATOTRINIDAD AND TOBAGOTTTRISTAN DA CUNHATUNISIATNTURKEYTRTURKMENISTANTMTURKS AND CAICOS ISLANDSTCTUVALUTVUGANDAUGUKRAINEUAUNITED ARAB EMIRATESAEUNITED KINGDOMGBUNITED STATESUNITED STATES MINOR OUTLYING ISLANDSUMURUGUAYUYUZBEKISTANUZVANUATUVUVENEZUELAVEVIET NAMVNVIRGIN ISLANDS, BRITISHVGVIRGIN ISLANDS, U.S.VIWALLIS AND FUTUNAWFWESTERN SAHARAEHYEMENYEYUGOSLAVIAYUZAMBIAZMZIMBABWEZWRADAR CHANNELSRDRALL CHANNELSALLmcs2gpo0 mcs2gpo1 mcs2gpo2 mcs2gpo3 mcs2gpo4 mcs2gpo5 mcs2gpo6 mcs2gpo7mcs5glpo0 mcs5glpo1 mcs5glpo2 mcs5glpo3 mcs5glpo4 mcs5glpo5 mcs5glpo6 mcs5glpo7mcs5gpo0 mcs5gpo1 mcs5gpo2 mcs5gpo3 mcs5gpo4 mcs5gpo5 mcs5gpo6 mcs5gpo7mcs5ghpo0 mcs5ghpo1 mcs5ghpo2 mcs5ghpo3 mcs5ghpo4 mcs5ghpo5 mcs5ghpo6 mcs5ghpo7pa2gw0a0 pa2gw1a0 pa2gw2a0pa2gw0a1 pa2gw1a1 pa2gw2a1pa5glw0a0 pa5glw1a0 pa5glw2a0pa5glw0a1 pa5glw1a1 pa5glw2a1pa5gw0a0 pa5gw1a0 pa5gw2a0pa5gw0a1 pa5gw1a1 pa5gw2a1pa5ghw0a0 pa5ghw1a0 pa5ghw2a0pa5ghw0a1 pa5ghw1a1 pa5ghw2a1pa0b0 pa0b1 pa0b2pa1lob0 pa1lob1 pa1lob2pa1b0 pa1b1 pa1b2pa1hib0 pa1hib1 pa1hib2tx_csum_olrx_csum_olagentsnoophost_auto_replypeer_auto_replyIDLEPRE-ISM Channel Availability Check(CAC)In-Service Monitoring(ISM)Channel Switching Announcement(CSA)POST-ISM Channel Availability CheckPRE-ISM Ouf Of Channels(OOC)POST-ISM Out Of Channels(OOC)WPA-NONEWPA-802.1xWPA-PSKWPA2-802.1xWPA2-PSKdisabledmic_erroricv_errorerrtraceprhdrsprpktinforminftmpoidasprusrpsdualwsec_dumplognrssiloftphycalmpcapstadfsbacacamsduampduffplddptcoexrtdcacidevidboardrevboardflagsboardflags2boardtypeboardnumccregrevledbh0ledbh1ledbh2ledbh3pa0b0pa0b1pa0itssitpa0maxpwraa2gaa5gag2pa1b0pa1b1pa1lob0pa1lob1pa1hib0pa1hib1pa1itssitpa1maxpwrpa1lomaxpwrpa1himaxpwrtri2gtri5gtri5glrxpo2grxpo5gtxchainrxchainantswitchtempthreshtempoffsettxpid2ga0txpid2ga1txpid2ga2txpid2ga3txpid5ga0txpid5ga1txpid5ga2txpid5ga3txpid5gla0txpid5gla1txpid5gla2txpid5gla3txpid5gha0txpid5gha1txpid5gha2txpid5gha3mcs2gpo0mcs2gpo1mcs2gpo2mcs2gpo3mcs2gpo4mcs2gpo5mcs2gpo6mcs2gpo7mcs5gpo0mcs5gpo1mcs5gpo2mcs5gpo3mcs5gpo4mcs5gpo5mcs5gpo6mcs5gpo7mcs5glpo0mcs5glpo1mcs5glpo2mcs5glpo3mcs5glpo4mcs5glpo5mcs5glpo6mcs5glpo7mcs5ghpo0mcs5ghpo1mcs5ghpo2mcs5ghpo3mcs5ghpo4mcs5ghpo5mcs5ghpo6mcs5ghpo7cddpostbcpobw40pobwduppoil0macaddret1macaddrleddcmaxp2gaitt2gaitt5gapa2gw0apa2gw1apa2gw2apa2gw3amaxp5gamaxp5ghamaxp5glapa5gw0apa5gw1apa5gw2apa5gw3apa5glw0apa5glw1apa5glw2apa5glw3apa5ghw0apa5ghw1apa5ghw2apa5ghw3asmanf sproductname2manfid 2prodid1sromrev2vendid 2devid 2chiprev 2subvendid 2subdevid2boardrev2pa0b0 2pa0b1 2pa0b2 1pa0itssit 1pa0maxpwr 1opo1aa2g 1aa5g1aa0 1aa11ag0 1ag1 1ag2 1ag34boardflags 4boardflags21ledbh0 1ledbh1 1ledbh2 1ledbh32ccode 1cctl2cckpo2ofdmpo2rdlid0rssismf2g 0rssismc2g 0rssisav2g 0bxa2g0rssismf5g 0rssismc5g 0rssisav5g 0bxa5g4xtalfreq1tri2g1tri5gl 1tri5g 1tri5gh1rxpo2g1rxpo5g2boardnum6macaddr2rdlsn2boardtype2leddc1rdlndis1txchain 1rxchain 2antswitch1regrev0antswctl2g, 0triso2g, 0pdetrange2g, 0extpagain2g, 0tssipos2g0antswctl5g, 0triso5g, 0pdetrange5g, 0extpagain5g, 0tssipos5g1maxp2ga0 1itt2ga0 2pa2gw0a0 2pa2gw1a0 2pa2gw2a0 1maxp5ga0 1itt5ga0 1maxp5gha0 1maxp5gla0 2pa5gw0a0 2pa5gw1a0 2pa5gw2a0 2pa5glw0a0 2pa5glw1a0 2pa5glw2a0 2pa5ghw0a0 2pa5ghw1a0 2pa5ghw2a01maxp2ga1 1itt2ga1 2pa2gw0a1 2pa2gw1a1 2pa2gw2a1 1maxp5ga1 1itt5ga1 1maxp5gha1 1maxp5gla1 2pa5gw0a1 2pa5gw1a1 2pa5gw2a1 2pa5glw0a1 2pa5glw1a1 2pa5glw2a1 2pa5ghw0a1 2pa5ghw1a1 2pa5ghw2a12cck2gpo 4ofdm2gpo 4ofdm5gpo 4ofdm5glpo 4ofdm5ghpo2mcs2gpo0 2mcs2gpo1 2mcs2gpo2 2mcs2gpo3 2mcs2gpo4 2mcs2gpo5 2mcs2gpo6 2mcs2gpo72mcs5gpo0 2mcs5gpo1 2mcs5gpo2 2mcs5gpo3 2mcs5gpo4 2mcs5gpo5 2mcs5gpo6 2mcs5gpo72mcs5glpo0 2mcs5glpo1 2mcs5glpo2 2mcs5glpo3 2mcs5glpo4 2mcs5glpo5 2mcs5glpo6 2mcs5glpo7 2mcs5ghpo0 2mcs5ghpo1 2mcs5ghpo2 2mcs5ghpo3 2mcs5ghpo4 2mcs5ghpo5 2mcs5ghpo6 2mcs5ghpo72cddpo2stbcpo2bw40po2bwduppo1rdlrwu1wpsgpio 1wpsled1usbfs4customvar1scblist_info’ū D’ū T’ū t’ū „’ū Ä’ū |’ū „’ū Œ’ū ”’ū œ’ū¼’ūĢ’ūÜ’ūü’ū ’ūY”’ūY¤’ūYÄ’ūY“’ūYŌ’ūYä’ūYōPņ¬’üžŒ’üžœ’üžČ’üžŲ’üžč’üž¬’ü ’ü ’ü <’ü L’ü \’ü  Pņ’üŃ“’üŃĄ’üŃĢ’üŃØ’üŃŲ’üќAC_BEAC_BKAC_VIAC_VO’’’’’’§K Ž"Ń$į')a+Ō.m1-47-:r=éA”EwI”MńRWs\¢bgļntž{‡‚ŁŠ™’Š›ƒ¤ŗ®|øÓĆĒĻ`ŪŖč®öx l q v { € … Š  ” ™ ž £ Ø “$<(P,d0x4Œ8 <“@Čd|hl¤pøtĢxą|ō€„ˆ0ŒD•q™…™”­ø8¼LĄ`ÄtČˆĢœŠ°ŌÄŲŲsocketwl_get_dev_typewl%s: wl driver adapter not found --interactive> exitInterface name change not allowed within --interactive %s: Unrecognized command "%s", type -h for help /proc/net/dev%s: cmd buffer not enough 2>2>&1/dev/ttywlctl%s: command not found %c%03x%x%d.%d.%d.%d((((( AAAAAABBBBBB §K Ž"Ń$į')a+Ō.m1-47-:r=éA”EwI”MńRWs\¢bgļntž{‡‚ŁŠ™’Š›ƒ¤ŗ®|øÓĆĒĻ`ŪŖč®öxw0–īa,™ QŗmÄpjōéc„5žd•£ۈ2yÜø¤ąÕé—Ņو ¶L+~±|½ēø-æ‘·dj° ņó¹qH„¾AŽŚŌ}mŻäėōŌµQƒÓ…Ēl˜VdkØĄżbłzŠeÉģ\OclŁś=c õ;n ČLi^Õ`Aä¢gqr<äŃKŌGŅ …ż„ µk5µØśB²˜lŪ»ÉÖ¬¼ł@2ŲlćEß\uÜÖ Ļ«Ń=Y&Ł0¬QŽ:Č×Q€æŠa!“ōµV³Ä#Ļŗ•™ø½„(øž_ˆĘ ٲ± é$/o|‡XhLĮa«¶f-=vÜAŪq˜Ņ ¼ļÕ*q±…‰¶µŸæä„čøŌ3xÉ¢ł4– ؎į˜j »m=-‘dl—ęc\kkQōlab…e0ŲņbNl•ķ„{‚ōĮõÄWe°ŁĘ·éP‹¾øźü¹ˆ|bŻßŚ-IŒÓ|óūŌLeM²aX:µQĪ£¼tŌ»0āJß„A=ؕפŃÄmÓÖōūCiéj4nŁü­gˆFŚ`øŠD-s3åŖ L_Ż |ÉPq<'AŖ¾ É †Whµ% o…³¹fŌ ĪaäŸ^Žł)ŁÉ˜°Š˜"Ēר“Y³=.“ ·½\;Ąŗl­ķøƒ šæ³¶¶ā t±ŅšźÕG9ŅwÆŪ&s܃ćc ”d;„ mj>zjZØäĻ “ ’ ®'}ž±š“D‡£ŅņhiĀž÷bW]€egĖl6qnkēžŌv‰Ó+ąŚzZgŻJĢł¹ßo޾ļł·¾C`°ŽÕÖÖ£č”ѓ~8ŲĀÄOßņRŃ»gń¦¼Wg?µŻH²6KŲ +ŚÆ L6JöAz`ß`ļĆØgßU1nŽļFi¾yĖa³Œ¼fƒ%oŅ Rhā6Ģ w•» G"¹U&/Åŗ;¾²½ (+“Z’\³jĀ×’§µŠĻ1,Łž‹[Ž®›d°ģcņ&uj£œm“ œ ©ė6?rg…W•æJ‚āøz{±+® ¶8’ŅŽ›åÕ¾ |Üļ· Ūß!†ÓŅŌńŌāBhݳųڃn¾Ķö¹&[o°wį·GwˆZę’jpf;Ź \ež’ųb®iak’ÓlĻE  āx× ŅīNƒT9³Ā§g&aŠ`÷IiGM>nwŪ®ŃjJŁÖZÜ@ß f7Ų;𩼮SŽ»žÅG²Ļ0µ’é½½ņʺŠS³“0$“£¦ŗŠ6ĶדTŽW)#Łgæ³fz.ÄaJø]h*o+”“ ¾7Ć Ž”Zß-ļ‰#2›F$W­e6tæŒHĮÆZ¾ÓŹlŪåé~ų÷3“"V„G,u·d>œÉ@æŪ®RŚķĖdł’čv!0‹™g&vÆD4U½­J¼ĆŽXŸŃėnśēČ|Łõ1ƒ ‘w§f.TµE<½Ė¬BžŁPūļźfŲżÉtBSapŸ ©'26»ĪLßÅķ^ü׈h™į«zŗóR…C q—`”(7³&:ŽĶĻDżßģV˜é‰`»ūŖrcr@Q%"4«0¹ļNžĒĢ\ŻÕ©jøćŠx›ńs‡bP•A5£$*±8’ĻīFÜŻĶT¹ėØbšł‹p„•§¶“Ā,Ó„į>š·@É+R:ŪNd_ķmv|’”‰…·›¦Ņ­Ć$ńæą6Į H;Ó*Z^åOl}÷l~„ “ƒ†—‘ć.ņ§Ą<ѵ)B8Ė PŁof~ļLt]żµ‹¤–™‡óÆā&нĮ49Ć(JŃ Xēnn\õM|Ę ×…åō—€(‘”£:²³JD[ĶiVxß `é/r>ū֍ĒõŸä© ³»¢2ZÅKLy×h^į h?ó.zēö‡ÄՕ”*°£‚8“±kFzĻHTYŻ-b<ėpł÷ęŌÅ±« "’¹ƒ0{ĒjNXÕI\=ć,jńx÷¹N%ҜkJ½óo˜Ö!”c-ڱF’Ž)gū BµˆĘ1Z­ć5Œ{ē©^ėR„Ī9w€”Vļ„s=Źž G°Ū,b•“C ś‘f(ßjÓ$Oøö יnņ¼Kv8ϤSźĖč¦Q:̓tĮ6xä]Ŗ‹|2Å®Yą*Ż“dų¶A`—Ł.E²ü ¾Iš›l"ÕōMŗŃ&hŸ%02x:%02x:%02x:%02x:%02x:%02x%d%s%s%sJ¬ņĄóóXó Čóšō ō(ōHōhō„ō ōĄōąōōõ õ Čõ€õˆõ°õĢõšöö4öTö`öl@öt€ö€öŒö˜>¤ö¤÷h’’’„0’’÷p.’÷pš!’’÷p’’’A’’÷|9’’÷|9’’Č’’÷|9’’Č=’’÷|"’’Č#’’÷|ą%’’Č&’’÷|’’’B’’ČC’’÷ˆ$’’Č%’’÷ˆą'’’Č(’’÷ˆ’’’D’’ČE’’÷”’’’ü’’÷ &’’÷ '’’÷ (’’÷ ą+’’÷ ’’’H’’÷¬.÷°<’÷°*’÷°ą#’÷°’’’J’÷ø2’÷Ą2’÷Č3’÷Š3’÷ø+’÷Ą+’÷Č,’÷Š,’÷øą;’÷Ąą;’÷Čą<’÷Šą<’÷ø’’’K’÷Ą’’’K’÷Č’’’L’÷Š’’’L’÷Ų/’’÷ą0’’ōģ1’’÷č8’÷ō4’÷Ų’’’a’’÷ą’’’b’’ōģ’’’c’’÷č’’’`’÷ō’’’`’üĄ <’üĄ’’’”’ų.0ųš.’ų’’’N’ų.Ąųš.’ų’’’N’*Ä:’*Š:’*Äš/’*Šš/’ųš0’üģš0’*Ä’’’O’*Š’’’O’ų’’’P’üģ’’’P’ų5’’ų6’’õ7’’ų$ ’’ų, ’’õ  ’’ų4 !’’ų< "’’õ0 #’’ųD8’ųP4’ų\ ’ųh ’ų’’’f’’ų’’’g’’õ’’’h’’ų$’’’i’’ų,’’’j’’õ’’’k’’ų4’’’l’’ų<’’’m’’õ0’’’n’’ųD’’’d’ųP’’’d’ų\’’’e’ųh’’’e’U(Tü(Tš(šTä(U’’’RTü’’’RTš’’’RšTä’’’RU4)U()U)šU)U4’’’SU(’’’SU’’’SšU’’’Sųt*’ų|*’ų„+’żČ+’ųt’’’T’ų|’’’T’ų„’’’U’żČ’’’U’ųŒ-’ų”-’ųŒ’’’V’ų”’’’V’ųœš=ų¤š=šų¬š=’ųœ’’’Qų¤’’’Qšų¬’’’Q’,’’’W,œ’’’W,Ø’’’Wų,“’’’W,¼’’’Wų,ō’’’X-’’’X- ’’’Xų-’’’X- ’’’Xųųø’’’Y’ųÄ’’’Y’ųŠš1’ųÜš1’ųčš2’ųōš2’łš3’ł š3’łš4’ł$š4’ł0š5’ł<š5’łHš6’łTš6’ł`š7’łlš7’łxš8’ł„š8’.8𜒒.8’’’ ’’.@š’’Ȟ’’.XšŸ’’Č ’’.Lš”’’Č¢’’.d𣒒Ȥ’’.@’’’”’’Č¢’’.X’’’£’’Ȥ’’.L’’’„’’Ȧ’’.d’’’§’’ČØ’’łš„’’łœš¦’’łØš§’’ł“𨒒łĄš©’’łĢšŖ’’łŲš«’’łä𬒒łšš­’’łüš®’’ś𯒒śš°’’ś š±’’ś,š²’’ś8š³’’śDš“’’śPšµ’’ś\š¶’’śhš·’’śtšø’’ś€š¹’’śŒšŗ’’ś˜š»’’ś¤š¼’’ś°š½’’ś¼š¾’’śČšæ’’śŌšĄ’’śąšĮ’’śģšĀ’’śųšĆ’’ūšÄ’’ł’’’©’’łœ’’’Ŗ’’łØ’’’«’’ł“’’’¬’’łĄ’’’­’’łĢ’’’®’’łŲ’’’Æ’’łä’’’°’’łš’’’±’’łü’’’²’’ś’’’³’’ś’’’“’’ś ’’’µ’’ś,’’’¶’’ś8’’’·’’śD’’’ø’’śP’’’¹’’ś\’’’ŗ’’śh’’’»’’śt’’’¼’’ś€’’’½’’śŒ’’’¾’’ś˜’’’æ’’ś¤’’’Ą’’ś°’’’Į’’ś¼’’’Ā’’śČ’’’Ć’’śŌ’’’Ä’’śą’’’Å’’śģ’’’Ę’’śų’’’Ē’’ū’’’Č’’ūšÅ’’ūšĘ’’ū šĒ’’ū(šČ’’ū’’’É’’ū’’’Ź’’ū ’’’Ė’’ū(’’’Ģ’’TÜ;’’TÜ)’’TÜą"’’TÜ’’’I’’T¤’’’ F’’T¤ą )’’T¤ &’’T¤ %’’ū0 $’’ū< *’’ūH’’’BM’’ūHąB-’’ūHB-’’ūHB>’’ūPš’ūXš’ū`š’ūhš’’ūpš’’ūxš’’ū€š’’ūˆš’ūš’ūœš’ūØš’’ū°š’’ūøš ’’ūĄš ’’ūČš ’’ūŌš ’’ūąš ’’ūģš’’ūųš’’üš’’üš’’üš’’ūP’’’’ūX’’’’ū`’’’’ūh’’’’’ūp’’’’’ūx’’’’’ūˆ’’’’ū’’’’ūœ’’’’ūØ’’’’’ū°’’’’’ūø’’’’’ūČ’’’ ’’ūŌ’’’ ’’ūą’’’ ’’ūų’’’ ’’ü’’’ ’’ü’’’’’żü(üü<üL üXüˆ ü”üÄüŠüÜ üš ż ż, ż< żDżLżTż|ż¤ż°żøżŠżŲżążģżųžž ž!ž "ž@#žH$žÄ%’€(<)p*Ą+!,Ą-Č.Š/Ų0ä1ģ2‚žČ’ČČl’’’’’’’’VDV\¦”’’’’’’’’Vd·<f<’’’’V$f<’’’’VĄZtf’’’’£VčWX ”W\WĢf<’’’’WŌXf<’’’’ X gÜœ°%&XnD¤4’’’’XDC`W8’’’’PXxXˆ8`O’’’’XX“W8’’’’PX¼ChW8O’’’’XčA<N˜’’’’Y (_„’’’’YPTL’’’’Y|T@­l’’’’’’’’Y¬T0­lO’’’’YŲT8­lOPYüZ ²’’’’Z0ķ€Ä ’’’’ZXä|’’’’ ZxZ“œ’’’’Z¼ģģœ’’’’Z¼ZąØÜb’’’’Zč[ ±€’’’’’’’’[R$›ą[D[”UV[˜[üWX\\H \P\œkl\¤]d@’’’’’’’’]]$d@’’’’’’’’](]Dāć]L]päå]x]  ]¤]Ō!"]Ų_˜ ’’’’^_˜’’’’’’’’_`(`0`Ģ`Ōaxa€bXbd%cH uvc|Čy¬’’’’cœcŌĻ,’’’’cܶXž„cō󜬚’’’’e4p÷0’’’’e(/ąū¤eøgū¤gg¼‹lŖ’’’’gÄgäø’’’’’’’’gģhth iƒ„i iPŠ“’’’’i\i|Ø©iˆiȐÜĀĆiŠj\Æü^_jd#šÆü`aj˜jŌÆü¦§jÜk$ÆüÄÅk,kh¬<efkpkĢcdkŲó¼­ų’’’’’’’’ll„Šl”ńlš lĄń0™pmšä˜@mLšŠ—TmØš¼–hmšn8eä’’’’nLX|nd n¬˜[Ų’’’’oLäüo(oDˆ’’’’oPōh³äopoĄ?@oČpL=>pTqžp#$qqP'’’’’qXqhx’’’’)qtqĄ«ģ’’’’’’’’qĢqų›ŠėģrQØ—8’’’’-r$Š{4’’’’-s°sčT,’’’’sšt]·’’’’ttX€H’’’’ČtdtŌ’’’’ŹtģuD¹$QRuTuœwxu v·¼’’’’’’’’vv0·¼’’’’’’’’v@vh¹’’’’yvtv¼¹’’’’zvČwę’’’’Éw(ó”“ō…†wp!h¹$wģ!d•ų¤„x0xč¹$xšy^L’’’’ y{äĒģ’’’’2yT'ĄÄš’’’’{ģ'ČÄš’’’’~4eä’’’’D%<01\€./ŒĢÖpõōŌ‚čwŌ3’’’’‚ōJÜwŌ’’’’ƒ<Œu“’’’’’’’’ƒ ¢u“’’’’’’’’ƒš„@f<’’’’4„L„td@Ł’’’’„€'$šŁ’’’’„œ„Ģ™ü’’’’„ą…Päč’’’’…\h<’’’’…¤…Ģst…܆$§¤’’’’<†(†Ģ¤ˆGH†ŌˆŒ©67ˆœ‰ˆ©89‰”‰ą:;‰ōŠ,¢T«¬Š8‹ ø¹‹4‹Pŗ»‹d‹”¼½‹¤‹Ģ‹ąŒ¾æŒŒ`ĄĮŒtŒ”Õ’’’’Œ ŒÄf<’’’’ÖŒŲ„Ų…STŒüˆ~XœŌŽĄ’’’’’’’’Üpw4‘=¼xEF’8’Ąij’Č” x{|“p”Š‹””\‡’’’’”d”˜’’’’\”¤•4’’’’]•<•Š’’’’J•Ü–ų‹|Ž–h—$øŒ’’’’——, “’’’’—4—\’’’’—h—¤‘’—ø˜“”˜˜ą›œ˜ģ™L‰8‰’’’’™T™€Sų’’’’˜™ˆ™“™Dmn™¼š•’’’’ššD²³š`šŠ–—šģ›4²³›H›“op›Ą›ųžœœ@xŸ’’’’œLœ€¢’’’’œˆœ“Œ’’’’œ¼ :,dd@’’’’’’’’pŒd@’’’’’’’’˜“d@’’’’’’’’ÄäņóģžĢ䞟 Ģ䟬”LŹø’’’’”X¢…H’’’’¢¢$ÓųÓŌ¢4¢ŠŚŪ¢Ü¢üÜŻ££(£,K|Ä£T£xsT’’’’£„£Øeä’’’’£ø£Ü£äK˜|Ĥ¤0¤<¤deä’’’’¤t¤„[ø¤¤øeä’’’’¤Ģ¤čxą’’’’¤ō„eä’’’’„$„Dęē„H„pKL„t„¤MN„¬„¼¹ö’’’’„Ģ„ų†ģ÷’’’’¦ 9l ¦<¦h¶”’’’’¦x¦ ¶”’’’’¦°¦Ō‰ ’’’’ś¦ą§• ’’’’ü§˜Ø»H’’’’Ø© ’’’’ž©Ģk’’’’©\7„’’’’«HE^d«p«”ÄĪĶ« «ä«č¬0€ų¬8¬„¬¬ŌĀ,¬äõd搭Į<Ų’’’’®L®\eä’’’’®pż ’’’’’’’’®„“š“®ŠōXØÆÆXf<’’’’ūÆ` t'(’’’’ÆtÆ”Ę¼’’’’ƤƼÅl’’’’ÆŠļŠ‘Ü’’’’Æģxģ± ’’’’° ° d@’’’’’’’’°,¤$’’’’°X°hXˆ’’’’°p±üXh’’’’²³\QØ’’’’³d³Œ’’’’³”³ŌQ8’’’’³Ü“Q8’’’’“(± ’’’’“P“\“h“œKČ“Ø“üKȵźĢģ’’’’µ\µ|µ”µŌ ’’’’µą¶3š’’’’¶¶T<×Ų¶`·@łų·L·€CD·ˆ·Ģ2D·Ų·š·ü?lµø(øL¹$øXø€¹$øŒø¤¹$ø“š“l’’’’øĢ¹4eä’’’’¹D¹`~X¹h¹ ~X’’’’¹Ø¹“Č ’’’’¹¼·ōr8¹Ģŗ,ŗ8Dóą’’’’ŗŒPóą’’’’ŗš»XŲ0’’’’»h»ōą ’’’’¼¼L|Ō’’’’¼\¼¼Ż€’’’’¼Č½<Śō’’’’½L¾’’’’¾/Tā3’’’’æ“¬Į˜ĮąiD’’’’ĮģĀ@Ŗ¼ĀH`ī’’’’Ā€Dī’’’’ĆhÜr˜’’’’ƬĆŲĆąÅ(Å8Bœ’’’’’’’’ÅlėœĘŌŌ t’’’’ĒTĒ“Øh’’’’Ē”ĒȾTĒŲõT¼ųČČ`»@ČlÉ\ßDÉdĖŪĖĶÖųĶ+ŃLĶÄ+¼ÓĶüäGT’’’’’’’’ΤŠĄŠŌŃŃ ŃpĶl’’’’5ŃxŅ·¼’’’’’’’’Ņ ŅPƒ¤Ņ\Ņxƒ¤Ņ„ҘKHҬą@’’’’’’’’ŌlÖ|.`քü<”’’’’’’’’Ö¤Ł0’’’’ŁHŁ dœ’’’’’’’’Ł“ŚoĢ’’’’’’’’ŚŚ€ڐŪT’’’’ŪhŪØn8’’’’’’’’Ū¼ņ„¤Ģ’’’’Üņ,¢’’’’ÜtÜÄ’’’’ÜŠŻ@’’’’ŻPŻØeä’’’’Ż“ŻĄ ’’’’ŻĢŻō ¬’’’’ŽŽ(謎4ŽØm(’’’’’’’’Žøwč¹ÜŅŃßßō²ģ’’’’’’’’ßüąką’’’’ą ąP©Šą`ąØ“’’’’ą¼įØjį°įä’’’’’’’’įčČā āāā$ā(ā0ā4āDāHāPāTā\ā`ālāpā|ā€ā”ā˜ź„ā¤ā¬ā°āøā¼­ĄāŠāÜāąėøāčāōāųććć ććć ć,ć0ć8ć<ćDćHćPćTć\ć`ćhćlćtćxć€ć„ćœć ć¬ć°ćĄćÄćĢćŠćšćōää äää,ä0ä8ä<äHäLäXä\å|ädäpätä„äˆä¤äØä°ä“会äĄäÄäŲäÜäšäōå åėˆåå$å(å0å4å\å`åpåtå€å„å”å˜å å¤å¬å°åøå¼åĢåŠåŲåÜåčåģåųåüęęęę ę(ę,ę8ę<ęPęTę\ę`ęhęlęxę|ę˜ęœ¼øę¬ę“ęøęĄęÄęĢęŠęąęäęųęüēēē$ē(ē0ē4ē<ē@älēHēPēTē`ēdēlēpē|ē€ēˆēŒē˜ēœē¤ēØē“ēøēÄēČēŠēŌēäēčēšēōēüčč$č(čHčLčXč\čhčlčtčxč€č„čŒččœč č¼čĄčČčĢčŌčŲćČčąéŒčččščōčüééé ééé$é(é0é4é@éDélépé„éˆéé”é é¤āXéČéŠéŌéÜéąņ¤éčéšéōź źź ź$ź0ź4ń(ź@źHźLźxź|źˆźŒź”ź˜ź¤źØź“źøźĄźÄźĢźŠźąźäźųźüėė ėėė(ė,ė4ė8ė@ėDėdėhė€ė„ėŒėėœė ė¬ė°ė¼ėĄķ ėČėŌėŲėąėäēģėģėōėųģģģģéģ,ģ<ģ@ģLģPģ\ģ`ģhģlģtģxģ€ģ„ģ”ģ˜ģ“ģøīhģĄńpģČģŌģŲģąģäķķķķķ(ķ,ķ8ķ<ē”ķDķPķTķ`ķdķlķpķ|ķ€ķŒķķ˜ķœķ¤ķØėØķ°ķÄķČķŠķŌćķäķüīī ī[”ī,īPīTī\ī`īlīpīˆīŒīœī īØī¬ī“īøīÄīČīŲīÜīčīģīųīüļļ ļļ  hļ(ļ8ļ<ļlļpDäļxļ„ļˆšļļœļ ļøļ¼ļČļĢļŌļŲļäļčššš š$š0š4šTšXšdšhš„šˆšš”šœš šØš¬šĄšÄšŲšąšäšģššńńń ń$ń,ń0ń8ń<ńDńHń`ńdńtńxå“ńˆń°ń“ń¼ńĄńĢńŠńŲńÜńčńģńųńüņņņ0ņ4ņHņLņ\ņ`ņhņlņxņ|ņ„ņˆņ”ņ˜ņØņ¬ņ¼õ8õDõPõXõ`õpöœö°ö“ö¼öÄö̰`öŌ öŲ@ö܀_<Œöąöäöģgäųp«h öš@ó”€öų÷÷÷€÷ ä@÷ €÷$÷,÷0@÷4÷8 ÷@@÷H÷P{äĆŲ÷T÷\÷d€āā€āp]ā`āPŽ4ā@&<ā0ā ?āāįšįąĮäĀ ĪšįŠJįĄ&į°į d|ÉTįƒį€WČįpį`µō>üįPį@żį0“œį įXh·xįąšąąąŠąĄU€ēXą°ą ąc4ą€ĀXąpfŒą`[<ąPą@bØą0ą ąJąßšßąߊߥ×Ģ-4ß°ß ߐ>č߀µßpÓÜüß`ßP